DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10553 and CG31288

DIOPT Version :10

Sequence 1:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:40 Identity:12/40 - (30%)
Similarity:22/40 - (55%) Gaps:2/40 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GELEFVEAKKILDIVCPKLPFKAMVVSQEMLEN--MKAEE 202
            |...:.|:.::.|.|.....:.|.|.:|:||.|  |:|::
  Fly   298 GSQLYYESTQVHDAVFKSKWYDASVATQKMLINCMMRAKK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10553NP_651383.1 EcKL 52..333 CDD:397213 12/40 (30%)
CG31288NP_733094.1 EcKL 50..331 CDD:397213 9/32 (28%)

Return to query results.
Submit another query.