DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CHKov2

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:423 Identity:153/423 - (36%)
Similarity:227/423 - (53%) Gaps:41/423 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PMPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSYM 73
            |.|.|:...||..|| ::...|:..|..|.|.:.:..||||.||:||:::|::|:|::||:|||:
  Fly     5 PTPQWVTKELFSSLL-EQSNRNFKAIIKFVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVSYI 68

  Fly    74 LKTPY-------DFEMYREILRKNNMFAVERDVFIQVIPELEQMY-KDVGVEVKFGAKAYEIDAP 130
            ||.|.       ||         :.||..|.|::..:|||||.:| |:..:..||  |...:..|
  Fly    69 LKIPLVPEDEKNDF---------HEMFDAELDMYDHLIPELEDLYAKNTSISPKF--KPVHLKFP 122

  Fly   131 -----DDYVLLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYLQPT 190
                 .||:||:||...|:||.||.:||:....:.||||:|||||.||.|:...|.|.:: ::.:
  Fly   123 GEPVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKD-IRES 186

  Fly   191 YADTMKESIEQVAETLGKYFLK-CLPLYEGYEEYS------AAVHKMQPKIVDLMYAMNTPDPQD 248
            |..|..:.:      |.::.:. |:|..|..::|:      ..:.....::.||.......||.:
  Fly   187 YFTTEHQKL------LDEFNINFCMPFLECMQQYNLEPGQLVLISDYTSQLTDLNIEFGKNDPLE 245

  Fly   249 FNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYF 313
            .:.|||||.|.:|.||||::.| |..:..|||.||||..:.|.||:..|:.|.||.|:|.:||||
  Fly   246 LSVLNHGDFWCNNFMFKYKNAS-EVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYF 309

  Fly   314 IKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLTDFVT 378
            |:|||..|||||.|||| ....|||...|..|.:|....:..|..:.|.|||....|:::.:.:.
  Fly   310 IEYYHQQLVEHLTMLNY-NRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHIGNVMG 373

  Fly   379 ETDNGDGLKLAMYSNARYKKHVSAILKWLNNRG 411
            .::.....|..|:....|...:..||.||.|||
  Fly   374 NSEEAIAFKRKMFLLPAYVDQIKVILPWLINRG 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 118/304 (39%)
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 118/304 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442587
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.