DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG10560

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster


Alignment Length:406 Identity:183/406 - (45%)
Similarity:267/406 - (65%) Gaps:7/406 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PMPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSYM 73
            |:|.|::..:||:|| |....:|...|:.:.:||:..||||:||||||:|:||.:|.:....::|
  Fly    16 PIPGWVKPEVFEDLL-KDNVKDYKKTKALRAKAGVAAGENYATIMLRLELDVETKDKSEVTKAFM 79

  Fly    74 LKTPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKAYEIDAPDDYVLLQD 138
            ||||:|.:.||::|::.|:|.|||.:::.|:|||||||:|||:||||||:||||...::||||:|
  Fly    80 LKTPHDTDAYRKLLQETNIFDVERGMYLVVVPELEQMYRDVGLEVKFGAEAYEIKVSENYVLLED 144

  Fly   139 LGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYLQPTYADTMKESIEQVA 203
            |.|.||:|||||:|||..||:.||:|.|||||.||.|:.|||||.:.|....:..  ||.:....
  Fly   145 LRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLKGPYEEKYTNGFFKS--KEIMNFFC 207

  Fly   204 ETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAMNTPDPQDFNALNHGDCWTSNIMFKYED 268
            :...|..|..:..|:|:..|...:..:..|:.|:...:..|...:||||||||.|::||||:|.|
  Fly   208 DRSAKILLNNIDQYDGHAAYIKDLQSVSEKLFDIYNDIKEPKSDEFNALNHGDGWSNNIMFQYND 272

  Fly   269 ESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLVEHLRMLNYPEA 333
            :: |...||||||||||..|||.||.||||.||..:|:..:||||:.:||..||:||::|||.: 
  Fly   273 KN-EISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFDYFVWFYHSELVKHLKLLNYSK- 335

  Fly   334 KTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLTDFVTETDNGDGLKLAMYSNARYKK 398
            |.|||..:...|.||....:..:..:...||||.|:||:....:  ::.......::|:|.||::
  Fly   336 KLPTLRSIRNALNKYSGWAFICSISVMGVVLLDPTDDADFDKII--SNEHSNFTNSIYTNPRYRR 398

  Fly   399 HVSAILKWLNNRGAFQ 414
            |:..:|.||.:|||.:
  Fly   399 HMKVVLPWLQHRGALE 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 144/284 (51%)
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 144/283 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442483
Domainoid 1 1.000 57 1.000 Domainoid score I17979
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.