DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG10550

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:407 Identity:133/407 - (32%)
Similarity:222/407 - (54%) Gaps:10/407 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSYML 74
            :|.|:....|:.::.|.. .|:..|.:..|.|...|||||::||:|:.:::.|:|.:.:.|||:|
  Fly    19 IPKWINEEYFQPIIEKDV-ENFDKIINLVPIAATAPGENYTSIMIRVIVDILLKDGSEQRVSYIL 82

  Fly    75 KTPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKAYEIDAPDDYV--LLQ 137
            ||..:.:...:::....:|..||.::...||:..::||:.|:|::...|...:||.|:.:  :.:
  Fly    83 KTMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELITMVFE 147

  Fly   138 DLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYLQPTYADTMKESIEQV 202
            ||....|:|.|||:|.|:.|.:.||:|:|:.||.|.....:.|||...|....|.:..::..|.:
  Fly   148 DLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMYNMSIYNEQSRDLFESL 212

  Fly   203 AETLGKYFLKCLPLY--EGYEEYSAAVHKMQP-KIVDLMYAMNTPDPQDFNALNHGDCWTSNIMF 264
            .:...:.|||.:..:  |..|.|.|.:  ..| ::.:....:|..|..:||.|||||||::||||
  Fly   213 GKQREEQFLKAMRNWDLENAESYIARM--WDPLEVFEEAVQVNQVDEDEFNVLNHGDCWSNNIMF 275

  Fly   265 KYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLVEHLRMLN 329
            .|:|.. |...|..||||:.|..|.|.||.|.:..|...:|::.:||:||:.||..|.|.|::||
  Fly   276 NYKDNG-EIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHFIQIYHQRLAECLKLLN 339

  Fly   330 YPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLTDFVTETDNGDGLKLAMYSNA 394
            |.: ..|||..||..:||||..|...|..:....|:...:|||:...:.:....|.::...:.|.
  Fly   340 YSK-PIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMPTDKDANMKMILAQGPEADAIRYRTFINP 403

  Fly   395 RYKKHVSAILKWLNNRG 411
            .|.|.:..:|.:.:|:|
  Fly   404 YYAKAMKVLLPFFDNKG 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 101/289 (35%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 101/289 (35%)
APH 108..338 CDD:279908 81/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.