DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG31370

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:421 Identity:93/421 - (22%)
Similarity:174/421 - (41%) Gaps:74/421 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLK-----------PGENYSTIMLRLKLEVELQ 63
            :|.||......::|           :|.:.|..|:           .|:||:::::|.::|...|
  Fly    12 VPEWLNEQFVTDVL-----------RSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQ 65

  Fly    64 DHTIENVSYMLKTPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKA--YE 126
            ...... |.::||      ..|:...:.:|..|..::.:|:||..::.::.....:..|:.  |.
  Fly    66 KGFFSK-SLIIKT------VLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYS 123

  Fly   127 IDAPDDYVLLQDLGPLGFRNV-DRLEGLDMVHTK-C-VLKKMAQWHAVSATRIHLKGPYPQNYLQ 188
            :: |...::.:|||.:.:..| ||:    :.|.: | ...|:|::||:|...|:.:         
  Fly   124 LE-PSQVMIFEDLGEMDYAMVRDRV----LTHGEICGAYSKLAKFHALSMKIINER--------- 174

  Fly   189 PTYADTMKE-----SIEQVAETLG--KYFLKCLPLYEGYEEY--SAAVHKMQPKIVDLMYAMNTP 244
            |.:....|:     .|..::..:|  |.||..:|..:.|:.:  ...||.:. ::.|:|....|.
  Fly   175 PEFVKEFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFID-RLRDIMKEYQTN 238

  Fly   245 DPQDFNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQ 309
            ....:..|.|||..|.|||.|:..||....:...:|.|...|..:|:||:|.:......|.::.:
  Fly   239 PQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGE 303

  Fly   310 FDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFI---------LCPPVLL 365
            .:..:.||...|.|.||.:.| :.|.|.......::  |....|...|:         |......
  Fly   304 LETLLNYYFSVLRETLRKIGY-QGKLPDPPAFWKEM--YRLKDYEFLFLSTYLPMSVGLSLETAT 365

  Fly   366 DRTEDANLTDFVTETDNGDGLKLAMYSNARY 396
            :...|..|.||:.|..:    .||.:..:.|
  Fly   366 NEETDDKLQDFIEECKS----ILARFERSGY 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 71/298 (24%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 71/298 (24%)
APH <202..320 CDD:279908 32/118 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.