DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG31098

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster


Alignment Length:434 Identity:100/434 - (23%)
Similarity:179/434 - (41%) Gaps:76/434 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PTWLRANLFEELLSKRY-----------------GGNYAGI------KSFKPEAGLKPGENYSTI 52
            |.||.|...:::|.:.:                 |...||.      .||..:.|..|...:|.|
  Fly    11 PEWLTAEFLQDVLKEHFKEEQLAVTELIVKSAQVGDQAAGFASEMHRASFNLQRGTAPKGKFSVI 75

  Fly    53 MLRLKLEVELQDH------TIENVSYMLKTPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMY 111
                     ::||      .:.:.|.:.|        ||||           .:.:|:|.::.:.
  Fly    76 ---------VKDHPKGQTGAVAHRSKLFK--------REIL-----------AYKEVLPRIQALL 112

  Fly   112 KDVGVEVKFGAKA-YEIDAPDDYVLLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSA-- 173
            :.:|.:.|..... |..::|:.:::|:|:...||.|.:|...|::.:....::|:|:.||.||  
  Fly   113 QSIGDQTKIAPTCYYTTESPEPFLILEDMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACSALI 177

  Fly   174 -------TRIHLKGPYPQNYLQPTYADTMKESIEQVAETLGKYFLKCLPLYEGYEEYSAAVHKMQ 231
                   .....:.|..:|..:..:......:|..|||.:..        ::||||.:..:..:.
  Fly   178 AQDSPEVLEFFDEAPISRNPDRRDFLTFFPVNIRCVAEEVAH--------WKGYEEITEKMFNLA 234

  Fly   232 PKIVDLMYAMNTPDPQDFNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYF 296
            ..::.....|.....:||...|..|.|.:|::|...:|:.||.:...:|.||..|.|...||.||
  Fly   235 ENVLQRALTMFESTGKDFRVFNLTDLWINNLLFHINNETKEPDDVVTLDFQLAYVGSPTIDLNYF 299

  Fly   297 LLGSTKFEIQLSQFDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCP 361
            |.||....::...:.|.::.|...|.:.|..||| :...|||..:|.:|:|...:|...|..|.|
  Fly   300 LYGSLNENVRKVHYKYIVREYQRVLQQTLEKLNY-QGHIPTLKEIHIELIKTSLMGVIGATCLTP 363

  Fly   362 PVLLDRTEDANLTDFVTETDNGDGLKLAMYSNARYKKHVSAILK 405
            .:..:.....||.|..:.|::||..:.....|.:|:..:...:|
  Fly   364 LIFREGAGFENLEDLNSRTESGDRFRRENVENPKYRAFLQRTIK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 68/300 (23%)
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 72/318 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
55.020

Return to query results.
Submit another query.