DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG31104

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:430 Identity:97/430 - (22%)
Similarity:176/430 - (40%) Gaps:53/430 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PTWLRANLFEELLSKRYGGNYAGIKSFK-PEAGLKP----GENYSTIMLRLKLEVELQDHTIENV 70
            |.||.|....::|.:     |..:...| .:..:.|    |::|:::|.|.|:|     :|....
  Fly    16 PAWLNAQFIGDILRE-----YEQLPDLKVTDLQVSPATAQGDHYASVMFRTKVE-----YTTPKG 70

  Fly    71 SY----MLKTPYDFEMY-REILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVK-FGAKAYEIDA 129
            .:    ::||..:.|.: :::|.::::|..|..::...:||.|::.::.|...| |....|....
  Fly    71 KFFKPLIIKTMPEQEGHKKDMLSESHLFETEIGMYCHALPEFERILREAGDNTKLFVPCIYHSLK 135

  Fly   130 PDDYVLLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYLQ------ 188
            |...::.:||.|.|: .|.|.....:...|....|:|:|||||...|: :.||.....|      
  Fly   136 PRQVMIFEDLVPQGY-TVIRDSPPSLGDLKLAFDKLAKWHAVSMKVIN-EQPYFLKEFQYGLFEM 198

  Fly   189 PTYADT---MKESIEQVAETLGKYFLKCLPLYEGYEEYSAAV--HKMQPKIVDL----MYAMNTP 244
            || .||   :...:....|.|.|     :|....|:.:...:  :.||...|::    .|..|  
  Fly   199 PT-IDTDPFITTGMTNFIEMLDK-----MPELRKYKHHFEKIKDNYMQRLEVEMHEYHKYRRN-- 255

  Fly   245 DPQDFNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQ 309
              ..:..|.|||....|:||::..|.....:...||.||..:..:..||.|.:....:.|.:...
  Fly   256 --DRYYVLCHGDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYSVYMLMEPEQRWEM 318

  Fly   310 FDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLT 374
            .:..|..|...||..||.:.| :...||...|..|:.......:.:.....|.::..::.|..:.
  Fly   319 GENLINEYFSVLVATLRKIGY-KGDMPTQRELWEQIQNNKYYDFFLISTFLPIMVGVKSNDLKMH 382

  Fly   375 DFVTETDNGDGLKLAMYSNARYKKHVSAILKWLNNRGAFQ 414
            :.:.::.    .:|..|....|.:.|..:|......|.|:
  Fly   383 EALQDSQ----ARLKSYFLDDYVQDVYKLLTKYEQLGYFK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 76/309 (25%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 75/305 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.