DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG14314

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:392 Identity:98/392 - (25%)
Similarity:164/392 - (41%) Gaps:87/392 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IKSFKPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSYMLKTPYDFEMYREILRKNNMFAVERD 98
            |.:|:...|...|:||:..:.|:||..:.:....|. :.:.|...:..:.||..:.:.:|..|..
  Fly    44 IDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQ-NVICKVMPESVVAREAYKSDKLFRNEVQ 107

  Fly    99 VFIQVIPELEQMYKDVGVEVKFGAKAYEIDAP------------DDYVLLQDLGPLGFRNVDRLE 151
            .:..::|||          :||.|.....|.|            .|.::::||...||:..||.:
  Fly   108 FYNTIMPEL----------LKFQASKTNQDTPVFNAIPKCYSARHDLLIMEDLRERGFQMSDRHK 162

  Fly   152 GLDMVHTKCVLKKMAQWHAVSATRIHLKGPYP-----------------------QNYLQPTYAD 193
            ||.:..|:.||.::||.|.:|   :..|...|                       :||    |..
  Fly   163 GLSLEETQSVLLQVAQLHGLS---LAYKFEKPLEFSNLCSMISEGIFCTANTSWYRNY----YER 220

  Fly   194 TMKESIEQVAETL---GKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAMNTPDPQDFNALNHG 255
            ..|.:|:.|:|.|   .||.|    ....:.|.|:...:|       :...:|..|  .:|:.||
  Fly   221 LTKNAIQMVSEVLPPDSKYVL----AMNKFAESSSFFGRM-------VKLASTESP--LSAICHG 272

  Fly   256 DCWTSNIMFKYEDESPEPI-ETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHD 319
            |||.:|.::.|:.|.|..: |...:|.||.:.:|:|.|:...|...|..|::.:|....:|.|.:
  Fly   273 DCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTE 337

  Fly   320 HLVEHLRML--NYPEAKTPTLGFLH----TQLLKYGRVGYHIAFIL----------CPPVLLDRT 368
            .|...|:||  |.|: ...||..|.    .:|..|||....:|..:          .|.:.|||:
  Fly   338 ELFRWLQMLCTNLPD-HCDTLQKLQDLFAEELKTYGRFALGLALDILPISTCSSEDAPDMYLDRS 401

  Fly   369 ED 370
            ::
  Fly   402 DE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 81/325 (25%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 79/320 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
44.060

Return to query results.
Submit another query.