DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and F59B1.10

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:319 Identity:68/319 - (21%)
Similarity:121/319 - (37%) Gaps:45/319 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RKNNMFAVERDVFIQVIPELEQMYKDV--------GVEVKFGAKAYEIDAPDDYVLLQDLGP-LG 143
            ::.|...:.::|..|:....|...|.:        .|..||.:|...|.....|..|.:... .|
 Worm    94 KQQNASLITKEVEEQMYAYFESSCKKMHNQEMNFYEVAGKFNSKTLLIPKVYFYTKLDEKNSNKG 158

  Fly   144 FRNVDRLEGLDMVHT--KC-------VLKKMAQWHAVSATRIHLKGPYP-QNYLQ-----PTYAD 193
            |..::.:||..:.|:  .|       :|:.:|:..|:|     |:.|.. ...||     ..:.:
 Worm   159 FIGMEYVEGSIVRHSYDTCTIEEIQPILRAIAKLQALS-----LQNPAEISKDLQKIDNGAIFQE 218

  Fly   194 TMKESIEQVAETLGKYFLKCLPLYEG-YEEYSAAVHKMQPKIVDLMYAMNTPDPQDF--NALNHG 255
            |:|..:.:  ..:...|.:|..|... :.|....:.:.:.:|:|...|.|.......  |.|.||
 Worm   219 TLKMMLSE--SGIKGIFEQCRNLERSRFGEKVDRIEEKRNEILDFEKAFNLNKVVGIKQNVLCHG 281

  Fly   256 DCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDH 320
            |.|.:|  |.:.:.:.....|..||.|:..:.:.|.||:..|:.:.....:.:.:...::.::.:
 Worm   282 DLWAAN--FLWTENNGVFCATRIVDYQMSHLGNPAEDLVRLLVSTITGADRQAHWQQILEQFYSY 344

  Fly   321 LVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLTDFVTE 379
            .:..|.....|.    ||..|......|..||   |..|.|  |.....||.|....:|
 Worm   345 FLNELGSGEAPY----TLEQLKLSFKLYFPVG---ALALLP--LFGPAVDAKLEGMDSE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 53/268 (20%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 68/319 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.