DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG9498

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster


Alignment Length:430 Identity:103/430 - (23%)
Similarity:180/430 - (41%) Gaps:46/430 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVEL-----QDHTIEN 69
            :|.:|..:.|.|.|.:....:...:|......|..||:||.:.:.|:.:....     :....|.
  Fly    12 VPEYLNEHFFTETLEEGLRESKVTLKEINFAWGSNPGDNYCSAIYRVGVSFARWADGGESPVTEQ 76

  Fly    70 VSYMLKTPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMYK-DVGVEVKFGAKAY-EIDAPDD 132
            :|.::|| .......:.|....:|..|:..:..|:|.|:.:.: |.     ||||.| .:..|..
  Fly    77 LSLIVKT-IPITEATQFLEDVCVFIKEKQTYTDVLPRLDILSRGDT-----FGAKYYHSVKTPVQ 135

  Fly   133 YVLLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVS---------ATRIHLKGPYPQNYLQ 188
            .::..||...||:...|.:|||..|...:|:::.::||.|         ..:.:.:|...::.|.
  Fly   136 TIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTRGMLSEDILM 200

  Fly   189 PTYADTMKESIEQVAETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAMNTPDPQD---FN 250
            .:      ::.||:.....|..:|....:.|||:.|..:.::.....::  ..:.|.|:.   :.
  Fly   201 KS------DTFEQMFGGFLKGLIKSSASWAGYEKISKHLQRLMDNFRNV--CADAPRPRKGDRYV 257

  Fly   251 ALNHGDCWTSNIMFKYEDES-PE-PIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYF 313
            .|||||.||:|.|:.|::.| |: |....|||.||....|.|.||.:||..|.|.::...:.:..
  Fly   258 VLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQLLQERREEL 322

  Fly   314 IKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLK---YGRVGY--HIAFILCPPVLLDRTEDANL 373
            ||.|:....:.|....:.:  .|:...|..:|..   ||..|.  .:..|..|..|.......|:
  Fly   323 IKVYYASFKDALEYARFED--IPSYEDLQYELRSRETYGLFGMFAFLPMITMPKELAQDNSIENM 385

  Fly   374 TDFVTETDNGDGLKLAMYSNARYKKHVSAILKWLNNRGAF 413
            .|...:....|    |::|......|....||..::.|.|
  Fly   386 QDEAFKQRKMD----AIFSQKFLNDHQKWALKRADSLGVF 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 77/305 (25%)
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 77/305 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.950

Return to query results.
Submit another query.