DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG33510

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:377 Identity:83/377 - (22%)
Similarity:132/377 - (35%) Gaps:117/377 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PTWLRANLFEELLSKRYGGNYAGIKSFKPEAG------LKPGENYSTIM---LRLKLEVELQDHT 66
            |.:.|.|..|....:......|.:.:.|.|.|      :.|...::..:   ..|..:.:|:|..
  Fly     8 PVFTRENRTELFTLEECNKILANLLADKNEQGVLLNFNIVPATEHTGFLGEYFHLYFQYQLEDQK 72

  Fly    67 IENVSYMLKTPYDF-----EMYREILRKNNMFAVERDV-FIQVIPELEQMYKDVGVEVKFGAKAY 125
            ....|.:......|     |.|.|     .|..:|::: ...::.||::..|.|     :.||.|
  Fly    73 DVQTSRLFVKSVIFQNANMEFYME-----KMGLIEKEIKLYDLLNELKKFSKHV-----WSAKCY 127

  Fly   126 EIDAPDDYVL--LQDLG----PLG--FRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPY 182
             ....|.:|:  ::|:|    |.|  |.|.:::..        :||.:|..||.|.         
  Fly   128 -FTRKDLFVMQNVEDMGYVALPPGTRFLNENQMGP--------ILKSLATLHASSI--------- 174

  Fly   183 PQNYLQPTYADTMKESIEQVAETLGKYFLKCL------PLYEGYEE------YSAAVH------- 228
                   .|.       :|..:|:|..|.|.|      |..|.|..      ..||:|       
  Fly   175 -------AYE-------KQQGKTIGVEFRKWLKEVSVDPEVEWYTTGLRAVLAVAAIHPDVLDNP 225

  Fly   229 -------KMQPKIVDLMYAMNTPDPQDFNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKV 286
                   :..|:.:|.:|.|..|.|...|...|.|.|.:|:.  |..|.|....:..||.||.:.
  Fly   226 EAQEYIAQELPRCLDKVYCMVNPSPVHRNVFVHRDAWNANVF--YHKEKPHEERSILVDFQLCRY 288

  Fly   287 TSVAYD--LIYFL----------LGSTKFEIQLSQFDYFIKYYHDHLVEHLR 326
            :..|.|  |:.:|          :||            .|:.|:|.|.|..|
  Fly   289 SPPAMDFHLVTYLNLEPFSRKKMIGS------------LIETYYDALAEEFR 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 75/337 (22%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 56/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.940

Return to query results.
Submit another query.