DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG33511

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:327 Identity:73/327 - (22%)
Similarity:128/327 - (39%) Gaps:79/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EAGLKPGENYSTIMLRLKLEVELQ-DHTIENVSYMLKT-PYDFEMYREILRKNNMFAVERDVFIQ 102
            :||.|....|.....:|.||.|:: |.....::|.:|: |...|..||...:..:|..|..::.|
  Fly    33 DAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQ 97

  Fly   103 VIPELEQMYKDVGVEVKFGAKAYEIDAPDDYVLLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQ 167
            ::|::::.     ...|...|.|.  :.:|.::|:|| ...:|::...|...:.|.|.||:.:::
  Fly    98 ILPKIQKY-----ATKKLYPKCYY--SRNDILVLEDL-TQDYRHLRANEYYTLDHYKIVLEHLSE 154

  Fly   168 WHAVSATRIHLKGPYPQNYLQPTYADTMKESIEQVAETLGKYFLKCLPLYEGYEEYSAAVH---- 228
            .||.|                  .|...||:::               :||.|:.....:|    
  Fly   155 LHAAS------------------IAWEEKENVK---------------IYESYKNVLIELHLDSN 186

  Fly   229 ------------------------KMQPKIVDLMYAMNT-------PDPQDFNALNHGDCWTSNI 262
                                    |.|..|.|.:|.:.|       |.....|.|.|.|.|..||
  Fly   187 NSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNI 251

  Fly   263 MFKYEDESPE-PIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLVEHLR 326
            ::.:..||.. |.....||.||.:..|...|:::.|......|::.:.:|..:::|:.:|..||.
  Fly   252 VYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLD 316

  Fly   327 ML 328
            .|
  Fly   317 RL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 70/322 (22%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 70/319 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.