DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG5126

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:434 Identity:88/434 - (20%)
Similarity:160/434 - (36%) Gaps:116/434 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YAGIKSFKPEAGLKPG--------ENYSTIMLRLKLEVELQDH---TIENVSYMLKTPYDFEMYR 84
            |...|:|.|.|.|:..        :.:.:.:..:.|:|.:.:.   .:..|.:|..|    |.:|
  Fly    17 YDIFKNFGPSASLESHSVECSNGLDGFMSALYTVTLDVVIAERKRTEVVLVKFMKGT----EEFR 77

  Fly    85 EILRKNNMFAVERDVFIQVIPELEQMYKDVGVE-------------VKFG-----------AKAY 125
            |.......|:.|...:.:::|..|.:.:...:|             .:||           ..|.
  Fly    78 ESSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLAL 142

  Fly   126 EIDAPDDYVLLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVS-ATRIHLKGPYPQNYLQP 189
            :....|.|    .|||......|:||.:        :..:..:||:. ||:|          |||
  Fly   143 KHLKGDGY----QLGPRLTLRRDQLEAM--------VGLVGPFHALGYATKI----------LQP 185

  Fly   190 TYADTMKESIEQV--AETLGKYFLKCL------PLYEGYEE------------YSAAVHKMQPK- 233
            .....::..:..:  ..:.||.....|      ..||.|:.            :.||:.:::.| 
  Fly   186 NVHARLRAGVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLREKY 250

  Fly   234 ----------IVDLMYAMNTPDPQDFNALNHGDCWTSNIMFKY-EDESPEPIETYFVDLQLPKVT 287
                      |....:|.:.|| ..|....|||...:|::|.| .::..:.|:.  :|.|..:.:
  Fly   251 FKQPTLLLERIRTSSFAEDQPD-SHFATFLHGDYNRNNVLFHYGAEDKVDAIKA--IDFQELRFS 312

  Fly   288 SVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLVEHLRML---NYPEAKTPTLGFLHTQLLK-- 347
            :.|.||.:|:..:|..|.:...:...::.||..::|.|.::   |..|.....:    .|||:  
  Fly   313 TTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRV----DQLLQEY 373

  Fly   348 -YGRVGYHI---AF---ILCP---PVLLDRTEDANLTDFVTETD 381
             :.|...|.   ||   ::|.   |.||...:|......:.|||
  Fly   374 SFERFNAHFKRYAFYGPMVCMHFLPWLLGTEKDCAELSRLFETD 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 65/355 (18%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 65/340 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.