DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG31300

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:421 Identity:92/421 - (21%)
Similarity:165/421 - (39%) Gaps:33/421 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSYMLK 75
            |.||.....||:||.........:...|.......|::|:::|.|...|.............:..
  Fly    18 PAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTAKGKFSRPLIIKA 82

  Fly    76 TPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVK-FGAKAYEIDAPDDYVLLQDL 139
            .|......:::|.::::|..|..::.||:||.|::.::.|.:.| |....|....|...::.:||
  Fly    83 MPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCIYHSLEPRKVMIFEDL 147

  Fly   140 GPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYL--QPTYADTMKESIEQV 202
            .|.|: .|.|...:.....|....|:|:|||:|           ..|:  ||.:....|..:.::
  Fly   148 VPQGY-YVIRDRPVAQEELKTAFAKLAKWHAIS-----------MKYIKEQPDFLKEFKYGLFEM 200

  Fly   203 AE-------TLG-KYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAM-----NTPDPQDFNALNH 254
            ..       |.| :.|::.|.......:|.....|::.|.:..:.|:     .......|..|.|
  Fly   201 PTVKTDPFITTGMQSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAVMKEYHENRKSDAFYVLCH 265

  Fly   255 GDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHD 319
            ||....|:|||....:....:|..||.|:..:..:..||.|.:....:.|.:.......|.:|..
  Fly   266 GDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLT 330

  Fly   320 HLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLTDFVTETDNGD 384
            .||..|:.:.|| .:.||...|..::.|.....:.:.....|.:|..:::...:.|.:.:.:.  
  Fly   331 VLVATLKSIGYP-GELPTQAKLWDEIHKNKYYDFFLLSTFLPLILAIKSKSFKVNDLIQDPET-- 392

  Fly   385 GLKLAMYSNARYKKHVSAILKWLNNRGAFQC 415
              :...|....|.|.||.:|......|.|:|
  Fly   393 --RQKTYFLDTYVKDVSKLLPKFEQLGYFKC 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 66/300 (22%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 66/300 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.