DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG31436

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:438 Identity:103/438 - (23%)
Similarity:192/438 - (43%) Gaps:76/438 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PTWLRANLFEELLSKRYGGN--YAGIK----SFKPEAGLKPGENYSTIMLRLKLEVELQDHTIEN 69
            |.||.:    |.:::...||  .|.:|    :|.|.:.  .|::|::||.|.:::...:....:.
  Fly    18 PEWLNS----EFMARVLEGNELEAAVKVIDLTFSPASA--KGDHYASIMFRARVKYTNRKGEFQK 76

  Fly    70 VSYMLKTPYDFEMY-REILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKA-YEIDAPDD 132
             |.::||..:.|.: :::|..:.:|..|..::.:|:||.|::.:.||.:.:..... |....|..
  Fly    77 -SLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYVNCIYHSLEPHQ 140

  Fly   133 YVLLQDLGPLGFRNV-DRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYLQPTYADT-- 194
            .::.:||..:|:..: ||...||.:  :.:..|:|:|||||     ||   .||. ||.:.::  
  Fly   141 VLIFEDLAEMGYIVLRDRDATLDEI--RRIYFKLAKWHAVS-----LK---VQNE-QPEFLESYT 194

  Fly   195 --------------MKESIEQVAETLGK--YFLKCLPLYEG---------YEEYSAAVHKMQPKI 234
                          |:..:|...|.|||  ...|..|.:|.         .||:. .:.|.|.| 
  Fly   195 HGLFEMPHVLNDPFMRTGMEFFVELLGKEPELNKYKPYFESIKDDFLERLVEEWK-DIRKSQKK- 257

  Fly   235 VDLMYAMNTPDPQDFNALNHGDCWTSNIMFKYEDE-SPEPIETYFVDLQLPKVTSVAYDLIYFLL 298
                        .::..|.|||....|||||::|. |.|  :...:|.|:..:..:.:||:|.:.
  Fly   258 ------------DEYWVLCHGDLHLRNIMFKHKDTVSLE--DCMLLDFQISNLFPLTFDLLYSIY 308

  Fly   299 GSTKFEIQLSQFDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPV 363
            ...:.|.:.:.:|..|.||...|.:.|:.:.| :...|:...|..:|.::....:.:.....|.:
  Fly   309 MLLEPEHRWNNWDDLINYYISVLQDVLKKIGY-KGVMPSQSGLWKRLHQHKYYEFFLISTFLPLM 372

  Fly   364 LLDRTEDANLTDFVTETDNGDGLKLAMYSNARYKKHVSAILKWLNNRG 411
            ...|.:..:..|.:   .|.:..:...:|.. |.|.|:.:|..|:..|
  Fly   373 WALRDKSVDFGDLL---QNEEKRRKCSFSKG-YIKEVTILLARLDQLG 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 78/315 (25%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 78/315 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459779
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.