DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and T16G1.3

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:324 Identity:61/324 - (18%)
Similarity:120/324 - (37%) Gaps:77/324 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 AVERDVFIQVIP-ELEQMYKDVGVEVKFGAKAYEIDAPDDYVLLQDLGPLGFRNVDRLEGLDMVH 157
            |:.|.::|.:.. ||..:.|.:.|   |.|::.:::.               |..:.:.|.|:  
 Worm   131 AITRHLYINLKSYELHSILKSLAV---FQAESLKLNK---------------REQESVTGYDL-- 175

  Fly   158 TKCVLKKMAQWHAVSATRIHLKGPYPQNYLQPTYADTMKESIEQVAETLGKYFLKCLPLYEGYEE 222
             :.::.||                :.||.|...:....:.:.|:::|...|              
 Worm   176 -EKIVGKM----------------FSQNGLNSIFEQVRQINKEELSEAADK-------------- 209

  Fly   223 YSAAVHKMQPKIVDLMYAMNTPDPQDFNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVT 287
              .||..::....||:..:|.......|.|.|||.|::|||:| |::....::. .:|.|...:.
 Worm   210 --IAVFGVELVNFDLVKNLNNYLGIKKNVLVHGDLWSANIMWK-ENKDEFRVDK-IIDYQSIHLG 270

  Fly   288 SVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVG 352
            :.|.||:...:.:.....:...::..::.::::.:|.|...|.|.    ||..|......|...|
 Worm   271 NPAEDLVRLFISTLSGSERQKYWEKLLEQFYEYFIEALEDKNVPY----TLEQLKESYRLYFVTG 331

  Fly   353 YHIAFILCPPV-------LLDRTEDANLTDFVTETDNGDGLKLAMYSNARYKKHV---SAILKW 406
            ..:...:..|:       :.|..|.....:.:||       |.....|....:|:   ..|.||
 Worm   332 SLLMLPMFGPIAEVKLAEMSDPDEVKKYREILTE-------KTKRLLNDMEHRHLYTREIIKKW 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 43/236 (18%)
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 58/315 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.