DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and E02C12.10

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_505430.3 Gene:E02C12.10 / 183989 WormBaseID:WBGene00017095 Length:417 Species:Caenorhabditis elegans


Alignment Length:239 Identity:51/239 - (21%)
Similarity:85/239 - (35%) Gaps:64/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 PTYADTMKESIEQVAETLGKYFLKCLPLYEGYEEYSAA------------VHKMQPKIVDLMYAM 241
            |.:.|.|.|.:..:.:..|.:  ..|.:..|.|..:..            :.|...||.:|:   
 Worm   202 PEFIDMMFEEVLSMDQIEGHF--DSLRILYGSEHLNTVETSITILRQYRMITKKYTKISELL--- 261

  Fly   242 NTPDPQDFN-ALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEI 305
                  .|. .|||||.|.||::...::.....::. .:|.|.........||...|:|.     
 Worm   262 ------GFKLVLNHGDLWQSNMLHCLDEFGNLKLKA-IIDWQGVSTLPPGLDLSRLLMGC----- 314

  Fly   306 QLSQFDYFIKYYHDHLVEHLRMLN-YPEAKTPTLG---FLHTQLLKYGRVGYHIAFILCPPVL-- 364
             ||.        |:.....|.||. |.|.....||   |...:|.....:.|.:..:|..|::  
 Worm   315 -LSA--------HERRERGLEMLKLYHETFNQVLGKELFSFQELQDSYNLYYPMMAMLLLPIVSS 370

  Fly   365 -LDRTEDANLTDFVTETDNGDGLKLAMYSNARYK--KHVSAILK 405
             ||.:.       ::|.:.         |.||.|  |::.|:::
 Worm   371 FLDNSP-------ISEVEK---------SQARIKNQKNMIAMME 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 33/154 (21%)
E02C12.10NP_505430.3 DUF1679 3..408 CDD:369592 51/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.