DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and F58B4.5

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 / 179513 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans


Alignment Length:227 Identity:41/227 - (18%)
Similarity:87/227 - (38%) Gaps:52/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYLQPTYADTMKESIEQVAETLGKYFLKCLPLY 217
            ||:|..:.:.:|     ::....:.||..:|:.||         |.:|::           |.:|
 Worm   207 LDIVFGQFMDEK-----SIERMNVLLKASFPEEYL---------EKVEEM-----------LKIY 246

  Fly   218 EGYEEYSAAVHKMQPKIVDLMYAMNTPDPQDF----NALNHGDCWTSNIMFKYEDESPEPIETYF 278
            :.|        ..||:::     .|..:...|    ..|.|.|.|:||.:...:.|  :......
 Worm   247 KDY--------YFQPQMI-----KNFKNTCQFFGYKPVLTHSDLWSSNFLCTRDGE--KVTLKAI 296

  Fly   279 VDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHT 343
            :|.|...:|:.|.|:..........:.:..:.|:.::.|::..|..|..::.|        :...
 Worm   297 IDFQTVSITTPAQDVGRLFASCLSTKDRREKADFLLEEYYNTFVNELDGMDVP--------YTFQ 353

  Fly   344 QLLKYGRVGYHIAFILCPPVLLDRTEDANLTD 375
            ||....:|.:.:...:..|.:....:.:|:|:
 Worm   354 QLKDSYQVYFPLMTTMVLPGIAPMLQHSNVTE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 34/180 (19%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:369592 41/227 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.