DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31087 and pkdc

DIOPT Version :9

Sequence 1:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:249 Identity:55/249 - (22%)
Similarity:83/249 - (33%) Gaps:67/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 KLKLFQKEEQMYHSILPKFEKLYADAGKPIQFAPKAFKFDRDLGVDYILLEDLH------RKNFK 153
            |::.:|.|...|.:....     .:...|:..|.|:|..::     .|:||||.      ||.:.
Zfish    73 KVRSYQVETYWYQNYTTN-----ENCRVPLCLAAKSFGEEQ-----LIVLEDLDVAGFPVRKTYV 127

  Fly   154 NANRLAGLDLDHMHKVLEKLAAFHAASACYVEHHGLFGEEFTVGVFSESNRQLLQEFNASGAFLA 218
            |...:..        .|..:|.|||. ...|...||    :.:|.:                   
Zfish   128 NDAEIKA--------CLSWIANFHAL-FLDVTPEGL----WPIGTY------------------- 160

  Fly   219 QLKKWKNAQKIYEKLADSDDYL------VDRLLQDQQYNTREFNVLNHGDCWANNVMYQHDAFGT 277
                |....:..|..|.||..|      :|.:|     |...|..:.|||....|..:..|..  
Zfish   161 ----WHLETRPEELEAMSDQKLKAAAGEIDSIL-----NNCRFKTIVHGDAKLANFCFSKDGL-- 214

  Fly   278 IKETLFVDFQVGKYGSPANDLYYLILSSAAPELKTAKFDYLVRYYFDNLIENLK 331
              :...||||....|....|:.|.:.|.........|...|:.|||..|.::|:
Zfish   215 --QVASVDFQYVGGGCGMKDVIYFLGSCMDERECEKKAPGLLDYYFSELRKSLE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 55/249 (22%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 51/221 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.