DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31087 and CG13658

DIOPT Version :9

Sequence 1:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:418 Identity:99/418 - (23%)
Similarity:184/418 - (44%) Gaps:56/418 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NEVPANNLPSWLSKISLEKAVQAQIGDFEKIISVIP-QKGSSDGDNYSTQFLRLLVEVELIDHST 73
            :||.|   |:||:...:|.|::|...|.|..::.:. ...:..||:|::...|.:..     :||
  Fly    13 DEVDA---PAWLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSH-----YST 69

  Fly    74 KDLSF----VLKAQ-----HSNEMMAAILAKLKLFQKEEQMYHSILPKFEKLYADAGKPIQ-FAP 128
            ...:|    ::|..     |..:|    |:...:|:.|..||...||:.|::..:||...: :||
  Fly    70 AKGNFSKALIVKTMPEQEGHKKDM----LSNSPIFKTEILMYSKALPELERILREAGDTTKLYAP 130

  Fly   129 KAFKFDRDLGVDYILL-EDLHRKNF-----KNANRLAGLDLDHMHKVLEKLAAFHAASACYVEHH 187
            ..:   ..|....::: |||..:.:     :..|:      :.:.|...|||.:||||...:...
  Fly   131 CIY---HSLEPHQVMIFEDLVPQGYTVIRDRYPNK------EELQKAFFKLAKWHAASMKVLNER 186

  Fly   188 GLFGEEFTVGVFSESNRQLLQEFNASG--AFLAQLKKWKNAQK---IYEKLADSDDYLVDRLLQD 247
            ..|.:||..|::...| .|......:|  .||..|.|.....|   .:||:  .|:|:.......
  Fly   187 PDFLKEFKYGLWGMPN-FLNDSIVTTGVPCFLEMLDKVPELTKYKPYFEKI--KDNYIQQMSAVM 248

  Fly   248 QQYNT----REFNVLNHGDCWANNVMYQHD-AFGTIKETLFVDFQVGKYGSPANDLYYLILSSAA 307
            ::|.|    ..:.||.|||....|:|:::: ..|:.::.:.||||:......:.||.|.|.....
  Fly   249 EEYRTNPKPNRYYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMD 313

  Fly   308 PELKTAKFDYLVRYYFDNLIENLKLLQYHRPLPKLKNLHASLFRNGLAAYMVVSKVLPVV--MLD 370
            .|.:.......:.|||..|.:.||.:.:...:|....:...:..:....:.:::..||:|  |..
  Fly   314 TEDRWDLGKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAAMNT 378

  Fly   371 KTADANLESYISDESKMKNAMFTNPKYV 398
            ||. .:::|:...::|.|:  |...:|:
  Fly   379 KTF-KSMDSFFDPQTKQKS--FFLDEYI 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 76/308 (25%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 76/309 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459799
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.