DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31087 and CG31104

DIOPT Version :9

Sequence 1:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:438 Identity:108/438 - (24%)
Similarity:187/438 - (42%) Gaps:58/438 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GHN-EVPANNL--PSWLSKISLEKAVQAQ-IGDFEKIISVIP---------QKGSSDGDNYSTQF 59
            |.| |..|:.|  |:||:         || |||..:....:|         ...::.||:|::..
  Fly     3 GKNIEYNADELQAPAWLN---------AQFIGDILREYEQLPDLKVTDLQVSPATAQGDHYASVM 58

  Fly    60 LRLLVEVELIDHSTKDLSF----VLKAQ-----HSNEMMAAILAKLKLFQKEEQMYHSILPKFEK 115
            .|..||     ::|....|    ::|..     |..:|    |::..||:.|..||...||:||:
  Fly    59 FRTKVE-----YTTPKGKFFKPLIIKTMPEQEGHKKDM----LSESHLFETEIGMYCHALPEFER 114

  Fly   116 LYADAGKPIQ-FAPKAFKFDRDLGVDYILLEDLHRKNFKNANRLAGLDLDHMHKVLEKLAAFHAA 179
            :..:||...: |.|..:...:...|  ::.|||..:.: ...|.:...|..:....:|||.:||.
  Fly   115 ILREAGDNTKLFVPCIYHSLKPRQV--MIFEDLVPQGY-TVIRDSPPSLGDLKLAFDKLAKWHAV 176

  Fly   180 SACYVEHHGLFGEEFTVGVFSESNRQLLQEFNASGA--FLAQLKKWKNAQKI---YEKLADSDDY 239
            |...:.....|.:||..|:| |........|..:|.  |:..|.|....:|.   :||:  .|:|
  Fly   177 SMKVINEQPYFLKEFQYGLF-EMPTIDTDPFITTGMTNFIEMLDKMPELRKYKHHFEKI--KDNY 238

  Fly   240 LVDRLLQDQQYNTREFN----VLNHGDCWANNVMYQHD-AFGTIKETLFVDFQVGKYGSPANDLY 299
            :....::..:|:....|    ||.|||....|:|::|: ..|...:.:.||||:........||.
  Fly   239 MQRLEVEMHEYHKYRRNDRYYVLCHGDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLT 303

  Fly   300 YLILSSAAPELKTAKFDYLVRYYFDNLIENLKLLQYHRPLPKLKNLHASLFRNGLAAYMVVSKVL 364
            |.:.....||.:....:.|:..||..|:..|:.:.|...:|..:.|...:..|....:.::|..|
  Fly   304 YSVYMLMEPEQRWEMGENLINEYFSVLVATLRKIGYKGDMPTQRELWEQIQNNKYYDFFLISTFL 368

  Fly   365 PVVMLDKTADANLESYISDESKMKNAMFTNPKYVQVMTEVLPWLDNRG 412
            |:::..|:.|..:...:.|......:.|.: .|||.:.::|...:..|
  Fly   369 PIMVGVKSNDLKMHEALQDSQARLKSYFLD-DYVQDVYKLLTKYEQLG 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 78/302 (26%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 78/303 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459797
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.