DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31087 and CG6830

DIOPT Version :9

Sequence 1:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:410 Identity:151/410 - (36%)
Similarity:249/410 - (60%) Gaps:9/410 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PAN--NLPSWLSKISLEKAVQAQIGDFEKIISVIPQKGSSDGDNYSTQFLRLLVEVELIDHSTKD 75
            |.|  .:|.||:....::.:.:...:||||:|...:..:..|||::::.|::.:|.:|.|:|.|.
  Fly   476 PENTDQIPDWLNIDDFKEIILSAEPNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKT 540

  Fly    76 LSFVLKAQHSNEMMAAILAKLKLFQKEEQMYHSILPKFEKLYADAGKPIQFAPKAFKFDRDLGVD 140
            .|::||....|:  |...:...||.||.::|.:.:|.||:.|.|.|.|:.|:||:|:..:|:..:
  Fly   541 FSYILKVHSDND--AINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKE 603

  Fly   141 YILLEDLHRKNFKNANRLAGLDLDHMHKVLEKLAAFHAASACYVEHHGLFGEEFTVGVFSESNRQ 205
            |:|||:|....||..:|:.|:||:|....|:|||.:||||..|.|.:|.:..::..|:|:|....
  Fly   604 YLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQTAP 668

  Fly   206 LLQEF--NASGAFLAQLKKWKNAQKIYEKLADSDDYLVDRLLQDQQYNTREFNVLNHGDCWANNV 268
            :.:..  |...:|:.::.|:....:...|:.:..|..|||:|:|.:.|.:.||||||||.|.||:
  Fly   669 IFKGMFVNTKKSFIEEVSKFDGVDEYLHKMPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNI 733

  Fly   269 MYQHDAFGTIKETLFVDFQVGKYGSPANDLYYLILSSAAPELKTAKFDYLVRYYFDNLIENLKLL 333
            |:|:::.|.:||||.:|.||.|||:||.||||.|:||...::|..:||||:|:|..|:.|:.|||
  Fly   734 MFQYESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLL 798

  Fly   334 QYHRPLPKLKNLHASLFRNGLAAYMVVSKVLPVVMLDKTADANLESYISDE---SKMKNAMFTNP 395
            .|:..:|.||.|||.|.::.:.|...|...|.:.:...|.|...:|::.:|   ..::.|||:|.
  Fly   799 NYNGFIPSLKELHAILIQHPIFAAGTVLTTLSMCLNKTTDDFTTDSFLGNEENGKSLREAMFSNE 863

  Fly   396 KYVQVMTEVLPWLDNRGLLD 415
            :|...:..|:||::.|||||
  Fly   864 RYRANIERVMPWINRRGLLD 883

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 113/284 (40%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 113/285 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442519
Domainoid 1 1.000 57 1.000 Domainoid score I17979
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12411
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.