DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31087 and CG13813

DIOPT Version :9

Sequence 1:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster


Alignment Length:438 Identity:102/438 - (23%)
Similarity:160/438 - (36%) Gaps:112/438 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ISVIPQKGSSDGDNYSTQFLRLLVEVELIDHSTKDLSFVLKAQHSNEMMAAILAKLKLFQKEEQM 105
            |.::.|..:..|:|...|.||:.... ::|.:|    .|:|....||...:.:..:..:.:|..|
  Fly    23 IPMVSQPMAGVGENAYGQVLRVSWPT-IVDAAT----VVVKMAPRNEARRSHMHVVDYYAREVFM 82

  Fly   106 YHSILPKFEKLYADAGKPIQFAPKAFKFDRDLGVDYILLEDLHRKNFKNANRLAGLDLDHMHKVL 170
            |..:.|.|..|..|. .....||.....|.....::::.|||....|:..:|......|.:...|
  Fly    83 YQKVFPVFRALSPDR-NTFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVCSL 146

  Fly   171 EKLAAFHAASAC--------------YVEHHGLFG---EEFTVGVFSESNRQLLQEFNASGAFLA 218
            :.||..||.|..              :||...||.   ||.|:            ||..     |
  Fly   147 KALAELHACSFILQQTDPLQFKQLVEFVEKDNLFTSDIEEVTI------------EFGK-----A 194

  Fly   219 QLKKWKNAQKIYEKLADSDD--------------------YLVDRLLQDQQYNTREFNVLNHGDC 263
            ||:|    .:|..|.:|.|.                    |.||...|      ....|:.|||.
  Fly   195 QLRK----ARIILKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQ------APHAVICHGDF 249

  Fly   264 WANNVMYQHDAFGTIK-ETLFVDFQVGKYGSPANDLYYLILSSAAPELKTAKF-DYLVRYYFDNL 326
            |.||::|:|:...... |...:|||:.:|..|..|:.:.:.:.....|:...| |::..||  |.
  Fly   250 WNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYY--NT 312

  Fly   327 IENLKLLQYHRPLPKLKNLHASL--------FRNGLAAYMV-------------VSKVLPVVMLD 370
            ::.           |||:.:.||        |...|..|.|             :|....|:.:|
  Fly   313 MDQ-----------KLKSCNLSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDID 366

  Fly   371 KTADA-NLESYISDESKMKNAMFTNPKYVQVMTEVLPWLDNR--GLLD 415
            ..::| ...|..|||.|.|..:   .:|..:....||....|  |:::
  Fly   367 TVSEAIQSISTSSDEPKYKELI---EEYEMLNARTLPIFKRRITGIVE 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 76/321 (24%)
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 79/332 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.