DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31087 and CG33511

DIOPT Version :9

Sequence 1:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:398 Identity:101/398 - (25%)
Similarity:175/398 - (43%) Gaps:63/398 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GSSDGDNYSTQFLRLLVEVELI-DHSTKDLSFVLKA-QHSNEMMAAILAKLKLFQKEEQMYHSIL 110
            ||.|...|..::.:|.:|.|:. |.....|::.:|: ...||.......:..:||||..:|..||
  Fly    35 GSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQIL 99

  Fly   111 PKFEKLYADAGKPIQFAPKAFKFDRDLGVDYILLEDLHRKNFKNANRLAGLDLDHMHKVLEKLAA 175
            ||.:| ||..    :..||.: :.|:   |.::|||| .:::::........|||...|||.|:.
  Fly   100 PKIQK-YATK----KLYPKCY-YSRN---DILVLEDL-TQDYRHLRANEYYTLDHYKIVLEHLSE 154

  Fly   176 FHAASACYVEHHGLFGEEFTVGVFSESNRQLLQEFNASG------------AFLA------QLKK 222
            .||||..:.|..       .|.:: ||.:.:|.|.:...            .|||      |..|
  Fly   155 LHAASIAWEEKE-------NVKIY-ESYKNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMK 211

  Fly   223 WKN--AQKIYEKLADSDDYLV-DRLLQDQQYNTREFNVLNHGDCWANNVMYQHDAFGTI--KETL 282
            .:|  ..|:|..|..:::.:. .:.::         |||.|.|.|.:|::|..:...::  ....
  Fly   212 AQNFIQDKLYNLLTKAEELVAPSKTIR---------NVLCHRDTWDHNIVYYFNKESSVLPNACC 267

  Fly   283 FVDFQVGKYGSPANDLYYLILSSAAPELKTAKFDYLVRYYFDNLIENLKLLQYHRPLPKLKNLHA 347
            .||||:.:|.||..|:.:|:...|:.|::.|.:|..:.:|:.||..:|..|...:.|....|...
  Fly   268 IVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRK 332

  Fly   348 SLFRNGLAAYMVVSKVLPVVMLDKTADANLES--------YIS-DESK-MKNAMFTNPKYVQ-VM 401
            ...|..|||.::.:...|...:..:....|.|        |:: |.|: :...:...|.|.: :|
  Fly   333 ECQRTRLAALVIWALTEPQTKMSPSISNRLRSEEPEKFDYYLNCDRSELLLRVIEIQPGYEETIM 397

  Fly   402 TEVLPWLD 409
            |.:...:|
  Fly   398 TPIRELVD 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 81/307 (26%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 80/304 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459704
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.