DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31087 and CG31099

DIOPT Version :9

Sequence 1:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:405 Identity:181/405 - (44%)
Similarity:273/405 - (67%) Gaps:6/405 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EVPANNLPSWLSKISLEKAVQAQIGDFEKIISVIPQKGSSDGDNYSTQFLRLLVEVELIDHSTKD 75
            :||  .:|.|:|.:||.:||.:.:.|..:|.||||........| .|..|.:.|:|:|.|.:.|.
  Fly     2 KVP--KIPDWVSSLSLNQAVHSVLEDGVQITSVIPSVHLIQFRN-CTVLLPIQVKVQLRDFTMKK 63

  Fly    76 LSFVLKAQHSNEMMAAILAKLKLFQKEEQMYHSILPKFEKLYADAGKPIQFAPKAFKFDRDLGVD 140
            |.|:|||||..::.|.::.:||:||:|.|:||::|||.|::|.:.||.:.|.|:||:.|..:||.
  Fly    64 LFFLLKAQHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQ 128

  Fly   141 YILLEDLHRKNFKNANRLAGLDLDHMHKVLEKLAAFHAASACYVEHHGLFGEEFTVGVFSESNRQ 205
            |:|||||..|::||..|.||.:...:.:||:|||.||||||..||.||.|......||::::|..
  Fly   129 YVLLEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAFSNLLVNGVYTKANES 193

  Fly   206 LLQEFNASGAFLAQLKKWKNAQKIYEKLADSDDYLVDRLLQDQQYNTREFNVLNHGDCWANNVMY 270
            :|||.|....||:||::|:.....:::|.:.:..|||.||:....::.|||||||.|||.||||:
  Fly   194 VLQELNDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNVLNHSDCWVNNVMF 258

  Fly   271 QHDAFGTIKETLFVDFQVGKYGSPANDLYYLILSSAAPELKTAKFDYLVRYYFDNLIENLKLLQY 335
            :.|..|.:::|..:|:|:.||||||.||||.|||||..::|.|:||.:|:|||.:|::|||.|.:
  Fly   259 KFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLKALNF 323

  Fly   336 HRPLPKLKNLHASLFRNGLAAYMVVSKVLPVVMLDKTADANLESYISDESKMKNAMFTNPKYVQV 400
            ...||:|:::..:|.:||||||:||::.||:.|:::..|...|.|   .||||.||||:.||:|.
  Fly   324 GGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFEDEVNERY---ASKMKCAMFTSRKYIQA 385

  Fly   401 MTEVLPWLDNRGLLD 415
            :.::|||::.|.||:
  Fly   386 IKDILPWMEERSLLN 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 131/282 (46%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 130/278 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442518
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.