DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31087 and CG33301

DIOPT Version :9

Sequence 1:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:418 Identity:117/418 - (27%)
Similarity:199/418 - (47%) Gaps:29/418 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LPSWLSKISLEKAVQAQIGDFE-KIISVIPQKGSSDGDNYSTQFLRLLVEVELIDHSTKDLSFVL 80
            ||:||:...|:..::|...|.. :::.:..:..:..|:|:.....|:.|:.:|.|.|..:.::::
  Fly     2 LPTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIV 66

  Fly    81 KAQHSNEM-MAAILAKLKLFQKEEQMYHSILPKFEKLYADAGKPIQFAPKAFKFDRDLGVDYILL 144
            |...|.|: .|.:..:.:|:.:|..||..||||.::|..:||...:....|...||:...  ::|
  Fly    67 KQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDREYNT--MIL 129

  Fly   145 EDLHRKNFKNANRLAGLDLDHMHKVLEKLAAFHAASACYVEHH-GLFGEEFTVGVFSESNRQLLQ 208
            |||....|.||:|:..||:.|....||.||.|||||....|.| .|..:.|....||...:....
  Fly   130 EDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKKAYSV 194

  Fly   209 EFNASGAFLAQLKKWKNAQKIYEKLADSDDYLVDRLLQDQQYNTREFNV-------LNHGDCWAN 266
            .|  :|.|.|.|:.......:.|...|....|...::   :|..|.::|       |||||||..
  Fly   195 VF--AGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIM---EYGARAYDVGESDLKTLNHGDCWTT 254

  Fly   267 NVMYQHDAFGTIKETLFVDFQVGKYGSPANDLYYLILSSAAPELKTAKFDYLVRYYFDNLIENLK 331
            |:|:|:|..|..:..:.:|||.....||..||:|...:|...|:.. |...||.:::..|..||:
  Fly   255 NIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGD-KESELVEHHYKALKANLE 318

  Fly   332 LLQYHRPLPKLKNLHASLFRN---GLAAYMVVSKVLPVVMLDKTADANLESYISDES----KMKN 389
            ...|...||.|:.......|.   .|.|:|    ..|.::.:.:.:.:..|.:..||    :.:.
  Fly   319 KFSYKGSLPTLQEYRLQFERRRFMSLLAHM----FKPCMIYNGSEETSDFSSLYAESPEGLRYQK 379

  Fly   390 AMFTNPKYVQVMTEVLPWLDNRGLLDLK 417
            :::.:...::..|::|..||.:|||:|:
  Fly   380 SVYASEAVIRSATKLLAILDAKGLLELQ 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 90/291 (31%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 90/292 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459385
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.