DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31087 and D1044.1

DIOPT Version :9

Sequence 1:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001367707.1 Gene:D1044.1 / 175763 WormBaseID:WBGene00017027 Length:376 Species:Caenorhabditis elegans


Alignment Length:189 Identity:47/189 - (24%)
Similarity:77/189 - (40%) Gaps:49/189 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 EKLAAFHAASACYVEHHGLFGEEFTVGVFSESNRQLLQEFNASGAFLAQLKK------WKNAQKI 229
            ||:|..    ||......::..:|..| |.||  |:||...|...|.|::.:      |||.:.:
 Worm   125 EKMAGL----ACEDYSGKVYSIDFVPG-FDES--QVLQLLEALAHFHAKIIEISDEIPWKNYENV 182

  Fly   230 ----------------YEKLADSDDYLVDRLL-------QDQQYNTREFN-------VLNHGDCW 264
                            :|||..::  |..|:.       :|...|:.:.|       |:.|.|..
 Worm   183 LYDAAYIRMLHNDTLDFEKLCPAE--LSGRIQEVKHAFDEDGVRNSEKKNEKLGMPLVICHNDLN 245

  Fly   265 ANNVMYQHDAFGTIKETLFVDFQVGKYGSPANDLYYLILSSAAPELKTAKFD-YLVRYY 322
            |:||::.::   |.|...|:|||....|..:.|:..::....:.|.:.|... ||..||
 Worm   246 ASNVLWNNE---TGKIQAFIDFQHVSKGPVSFDIIRILCLGLSVENRRANTQRYLNHYY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 47/189 (25%)
D1044.1NP_001367707.1 CHK 130..308 CDD:214734 44/184 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.