DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and pkdc

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:326 Identity:59/326 - (18%)
Similarity:101/326 - (30%) Gaps:106/326 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DILLKD--------GSEQRVSY-----ILKTMLEADSGADVIDGMGLFPKERK------------ 106
            |::||:        |::.:..:     |::..||......|:....:||:.:|            
Zfish     7 DLVLKECGAKSLQIGAKIQTLWSGYGEIIRVHLEGCDRPSVVVKHVMFPQNQKHPGGWNTDISHQ 71

  Fly   107 ----MYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELITMVFEDLS------RQNFKNFDRLK 161
                .|:|....:..........:   |.||...:..|...:|.|||.      |:.:.|...:|
Zfish    72 RKVRSYQVETYWYQNYTTNENCRV---PLCLAAKSFGEEQLIVLEDLDVAGFPVRKTYVNDAEIK 133

  Fly   162 GFDLPHMREVLRKLAELHAASV-VAKEINGPYDAMYNMSIYNEQSRDLFESLGKQREEQFLKAMR 225
            .        .|..:|..||..: |..|...|....:::....|:                |:||.
Zfish   134 A--------CLSWIANFHALFLDVTPEGLWPIGTYWHLETRPEE----------------LEAMS 174

  Fly   226 NWDLENAESYIARMWDPLEVFEEAVQVNQVDEDEFNVLNHGDCWSNNIMFNYKDNGEIDRTILVD 290
            :..|:.|...|..:               ::...|..:.|||....|..|: ||..::   ..||
Zfish   175 DQKLKAAAGEIDSI---------------LNNCRFKTIVHGDAKLANFCFS-KDGLQV---ASVD 220

  Fly   291 LQVGKWGSPAQDLWYLITTSASLDIKIKEFDHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMML 355
            .|....|...:|:.|.                        |..|:......|..|.|.|.:...|
Zfish   221 FQYVGGGCGMKDVIYF------------------------LGSCMDERECEKKAPGLLDYYFSEL 261

  Fly   356 K 356
            :
Zfish   262 R 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 54/308 (18%)
APH 108..338 CDD:279908 43/236 (18%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 46/234 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.