DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and CHKov2

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:416 Identity:137/416 - (32%)
Similarity:229/416 - (55%) Gaps:25/416 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PKWINEEYFQPIIEKDVENFDKIINLVPIAATAPGENYTSIMIRVIVDILLKDGSEQRVSYILKT 84
            |:|:.:|.|..::|:...||..||..||.:|.:.||||.:|::|:.:::.|||.|.:.||||||.
  Fly     7 PQWVTKELFSSLLEQSNRNFKAIIKFVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVSYILKI 71

  Fly    85 MLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKC--LHVDATDELIT---M 144
            .|..:...:  |...:|..|..||:..||:...||.:   ...::||.  :|:....|.:.   :
  Fly    72 PLVPEDEKN--DFHEMFDAELDMYDHLIPELEDLYAK---NTSISPKFKPVHLKFPGEPVKSDYI 131

  Fly   145 VFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEI--NGPYDAMYNMSIYNEQSRD 207
            :.|||.::.::|.||.:|.:...:..||:|||:.||||  ||.:  .|.|:.....|.:..:.:.
  Fly   132 LLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAAS--AKRVVELGEYEKDIRESYFTTEHQK 194

  Fly   208 LFESLGKQREEQFLKAMRNWDLENAE-----SYIARMWDPLEVFEEAVQVNQVDEDEFNVLNHGD 267
            |.:.........||:.|:.::||..:     .|.:::.|      ..::..:.|..|.:||||||
  Fly   195 LLDEFNINFCMPFLECMQQYNLEPGQLVLISDYTSQLTD------LNIEFGKNDPLELSVLNHGD 253

  Fly   268 CWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHFIQIYHQRLA 332
            .|.||.||.||:..|::....||.|:.|:|:|||||..::.||....||:.:||:||:.|||:|.
  Fly   254 FWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIEYYHQQLV 318

  Fly   333 ECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMPTDKDANMKMILAQGPEADAIRY 397
            |.|.:|||::..|||...|..:.:|..|..:.|..::...|:|.|.|:::..::....||.|.:.
  Fly   319 EHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHIGNVMGNSEEAIAFKR 383

  Fly   398 RTFINPYYAKAMKVLLPFFDNKGLLK 423
            :.|:.|.|...:||:||:..|:|.::
  Fly   384 KMFLLPAYVDQIKVILPWLINRGYIR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 100/298 (34%)
APH 108..338 CDD:279908 78/241 (32%)
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 100/298 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.