DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and CG10560

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster


Alignment Length:429 Identity:153/429 - (35%)
Similarity:243/429 - (56%) Gaps:21/429 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPNNSAEKPVNPNEHLHIPKWINEEYFQPIIEKDVENFDKIINLVPIAATAPGENYTSIMIRVI 65
            |.|..:.|...  ...:.||.|:..|.|:.:::.:|:::.|...|...|..|.||||.:||:|:.
  Fly     1 MPPQTNDENVC--EREVPIPGWVKPEVFEDLLKDNVKDYKKTKALRAKAGVAAGENYATIMLRLE 63

  Fly    66 VDILLKDGSEQRVSYILKTMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAP 130
            :|:..||.||...:::|||..:.|:...::....:|..||.||.|.:|:..::|::.|||::...
  Fly    64 LDVETKDKSEVTKAFMLKTPHDTDAYRKLLQETNIFDVERGMYLVVVPELEQMYRDVGLEVKFGA 128

  Fly   131 KCLHVDATDELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAM 195
            :...:..::..:  :.|||..:.|||.|||:|.|..|...||||.|:.||||.|..::.|||:..
  Fly   129 EAYEIKVSENYV--LLEDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLKGPYEEK 191

  Fly   196 YNMSIYNEQSRDLFESLGKQREEQFLKAMRNWD-----LENAESYIARMWDPLEVFEEAVQVNQV 255
            |....:  :|:::......:..:..|..:..:|     :::.:|...:::|   ::.:   :.:.
  Fly   192 YTNGFF--KSKEIMNFFCDRSAKILLNNIDQYDGHAAYIKDLQSVSEKLFD---IYND---IKEP 248

  Fly   256 DEDEFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEF 320
            ..||||.|||||.|||||||.|.|..||..|..||||:.||||.||||:|.:.:|.|||||.::|
  Fly   249 KSDEFNALNHGDGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKF 313

  Fly   321 DHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVM-VATLMPTDKDANMKM 384
            |:|:..||..|.:.||||||||.:||||.:...:.||..|..:.::.|| |..|.||| ||:...
  Fly   314 DYFVWFYHSELVKHLKLLNYSKKLPTLRSIRNALNKYSGWAFICSISVMGVVLLDPTD-DADFDK 377

  Fly   385 ILAQGPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLLK 423
            |::.  |........:.||.|.:.|||:||:..::|.|:
  Fly   378 IISN--EHSNFTNSIYTNPRYRRHMKVVLPWLQHRGALE 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 108/291 (37%)
APH 108..338 CDD:279908 86/234 (37%)
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 108/290 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442495
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.