DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and CG10553

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster


Alignment Length:420 Identity:143/420 - (34%)
Similarity:225/420 - (53%) Gaps:37/420 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IPKWINEEYFQPIIEKDVENFDKIINLVPIAATAPGENYTSIMIRVIVDILLKDGSEQRVSYILK 83
            ||.|:....|:.::::.|:::....::...|..|.||||.::|:|:.:|:..:|.::...:::||
  Fly    17 IPDWVKPTVFEELLKRIVKDYKATKSMRANAGVAAGENYATVMLRIELDVEKEDNTQTTKAFMLK 81

  Fly    84 TMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELITMVFED 148
            |..:::....||:...:|..||.||...:|:..:||::.|||::...:...::|:|..:  :.||
  Fly    82 TPHQSEQYRKVIEKTDIFDVERGMYVEVVPELEQLYRDVGLEVKFGAELYDIEASDYYV--LLED 144

  Fly   149 LSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMYNMSIYNEQSRDLFESLG 213
            |..:.|.|.|||:|.|..|...||:|.|:.||||.|..|..|||...|              :.|
  Fly   145 LRPRGFGNIDRLEGMDQAHTECVLKKFAQWHAASAVRVETKGPYQEKY--------------TKG 195

  Fly   214 KQREEQFLKAMRNWD----LENA------ESYIARMWDPLEV-----FEEAVQVNQVDEDEFNVL 263
            ..|.|:.:.|..|..    |:|.      |:|:    :.|.:     ||....:|....|||..|
  Fly   196 FLRNEEIVDAFINRSIKVFLDNVHLCKGYETYL----NDLRIVSGKTFEIVESLNNPSPDEFIAL 256

  Fly   264 NHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHFIQIYH 328
            ||||.|:||||..|...|||..|..|||||.||||..|||:|.:.:|.|||||..:||:||..||
  Fly   257 NHGDGWANNIMSQYNTKGEIQDTYFVDLQVPKWGSVTQDLYYFLLSSTSLDIKTSKFDYFIWFYH 321

  Fly   329 QRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMPTDKDANMKMILAQGPEAD 393
            ..|.:.||||.|||.:||||.::..:.||..|..:....::...|:.....|:...:|  |.:..
  Fly   322 SELVKHLKLLGYSKTLPTLRRINDALNKYSGWSFICTATILAYVLLDPVDGADFDKVL--GDDDC 384

  Fly   394 AIRYRTFINPYYAKAMKVLLPFFDNKGLLK 423
            :.:...:|||.:.|.|:||||:..::|.::
  Fly   385 SFKNSLYINPRFRKHMEVLLPWLQHRGAME 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 112/301 (37%)
APH 108..338 CDD:279908 93/244 (38%)
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 112/300 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442510
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.