DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and CG31370

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:439 Identity:105/439 - (23%)
Similarity:186/439 - (42%) Gaps:80/439 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EHLHIPKWINEEYFQPIIEKDVENFD-KIINLVPIAATAPGENYTSIMIRVIVDILLKDGSEQRV 78
            :.|::|:|:||::...::....:..| ::..|.....:|.|:||.|::||..|:.:.:.|...: 
  Fly     8 DQLNVPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSK- 71

  Fly    79 SYILKTMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELIT 143
            |.|:||:||      :..|..||..|..||...:|:|.::.:|......|..:|::.......: 
  Fly    72 SLIIKTVLE------MFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQV- 129

  Fly   144 MVFEDLSRQNFKNF-DRLKGFDLPH--MREVLRKLAELHAASVVAKEINGPYDAMYNMSIYNEQS 205
            |:||||...::... ||:    |.|  :.....|||:.||.|               |.|.||:.
  Fly   130 MIFEDLGEMDYAMVRDRV----LTHGEICGAYSKLAKFHALS---------------MKIINERP 175

  Fly   206 RDLFE-------------SLGKQREEQFLKAMRNWD-----LENAE-SYIARMWDPLEVFEEAVQ 251
            ..:.|             |.|....:.||..:...|     .|..| .:|.|:.|.::.::...|
  Fly   176 EFVKEFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQ 240

  Fly   252 VNQVDEDEFNVLNHGDCWSNNIMFNY-KDNGEIDRTILVDLQVGKWGSP-AQDLWYLITTSASLD 314
            ..      :.||.|||..:.|||..: |::|..:..:|:|.| |.:.:| |.||.|.|....:.:
  Fly   241 PG------YYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQ-GCYVAPLAFDLMYSIYMLMNRE 298

  Fly   315 IKIKEFDHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMG----VMVATLMP 375
            .:|.|.:..:..|...|.|.|:.:.|...:|.         ...||..:..:.    :.::|.:|
  Fly   299 QRIGELETLLNYYFSVLRETLRKIGYQGKLPD---------PPAFWKEMYRLKDYEFLFLSTYLP 354

  Fly   376 TDKDANMKMILAQGPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLLKS 424
              ....:.:..|...|.|. :.:.||     :..|.:|..|:..|..::
  Fly   355 --MSVGLSLETATNEETDD-KLQDFI-----EECKSILARFERSGYFEN 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 82/310 (26%)
APH 108..338 CDD:279908 63/253 (25%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 82/310 (26%)
APH <202..320 CDD:279908 34/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459753
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.