DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and CG31098

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster


Alignment Length:435 Identity:102/435 - (23%)
Similarity:200/435 - (45%) Gaps:50/435 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NEHLHIPKWINEEYFQPII-----EKDVENFDKIINLVPIAATAPGENYTSIMIRVIVDILLKDG 73
            :::...|:|:..|:.|.::     |:.:...:.|:....:...|.|  :.|.|.|...::.....
  Fly     5 SKNYQAPEWLTAEFLQDVLKEHFKEEQLAVTELIVKSAQVGDQAAG--FASEMHRASFNLQRGTA 67

  Fly    74 SEQRVSYILKTMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDAT 138
            .:.:.|.|:|...:..:|| |.....||.:|...|:..:|:...|.:..|.:.::||.|.:...:
  Fly    68 PKGKFSVIVKDHPKGQTGA-VAHRSKLFKREILAYKEVLPRIQALLQSIGDQTKIAPTCYYTTES 131

  Fly   139 DELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMYNMSIYNE 203
            .|.. ::.||:....|:||:|.:..:|.::...:.|:|:|||.|.:..:     |:...:..::|
  Fly   132 PEPF-LILEDMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACSALIAQ-----DSPEVLEFFDE 190

  Fly   204 Q--SRDLFESLGKQREEQFL-----------KAMRNWDLENAESYIARMWDPLE-VFEEAVQVNQ 254
            .  ||:       .....||           :.:.:|  :..|....:|::..| |.:.|:.:.:
  Fly   191 APISRN-------PDRRDFLTFFPVNIRCVAEEVAHW--KGYEEITEKMFNLAENVLQRALTMFE 246

  Fly   255 VDEDEFNVLNHGDCWSNNIMFNY-KDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIK 318
            ....:|.|.|..|.|.||::|:. .:..|.|..:.:|.|:...|||..||.|.:..|.:.:::..
  Fly   247 STGKDFRVFNLTDLWINNLLFHINNETKEPDDVVTLDFQLAYVGSPTIDLNYFLYGSLNENVRKV 311

  Fly   319 EFDHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVMVAT-LMPT--DKDA 380
            .:.:.::.|.:.|.:.|:.|||...||||:::||.::|      .:.|||:.|| |.|.  .:.|
  Fly   312 HYKYIVREYQRVLQQTLEKLNYQGHIPTLKEIHIELIK------TSLMGVIGATCLTPLIFREGA 370

  Fly   381 ---NMKMILAQGPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLL 422
               |::.:.::....|..|.....||.|...::..:..|:..|.|
  Fly   371 GFENLEDLNSRTESGDRFRRENVENPKYRAFLQRTIKEFELSGFL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 69/301 (23%)
APH 108..338 CDD:279908 55/244 (23%)
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 69/300 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.