DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and CG31104

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:433 Identity:115/433 - (26%)
Similarity:189/433 - (43%) Gaps:49/433 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EHLHIPKWINEEYFQPIIEKDVENFD-KIINLVPIAATAPGENYTSIMIRVIVDILLKDGSEQRV 78
            :.|..|.|:|.::...|:.:..:..| |:.:|....|||.|::|.|:|.|..|:.....|...: 
  Fly    11 DELQAPAWLNAQFIGDILREYEQLPDLKVTDLQVSPATAQGDHYASVMFRTKVEYTTPKGKFFK- 74

  Fly    79 SYILKTMLEADS-GADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELI 142
            ..|:|||.|.:. ..|::....||..|..||...:|:|.::.:|||...:|...|::.......:
  Fly    75 PLIIKTMPEQEGHKKDMLSESHLFETEIGMYCHALPEFERILREAGDNTKLFVPCIYHSLKPRQV 139

  Fly   143 TMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEIN-GPY---DAMYNMSIYNE 203
             |:||||..|.: ...|.....|..::....|||:.||.|:  |.|| .||   :..|.:.....
  Fly   140 -MIFEDLVPQGY-TVIRDSPPSLGDLKLAFDKLAKWHAVSM--KVINEQPYFLKEFQYGLFEMPT 200

  Fly   204 QSRDLF---------ESLGKQREEQFLKAMRNWDLENAESYIARMWDPLEVFEEAVQVNQVDE-- 257
            ...|.|         |.|.|..|   |:..::...:..::|:.|:         .|::::..:  
  Fly   201 IDTDPFITTGMTNFIEMLDKMPE---LRKYKHHFEKIKDNYMQRL---------EVEMHEYHKYR 253

  Fly   258 --DEFNVLNHGDCWSNNIMFNY-KDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKE 319
              |.:.||.|||....|:||.: |:.|..|..:|||.|:........||.|.:......:.:.:.
  Fly   254 RNDRYYVLCHGDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYSVYMLMEPEQRWEM 318

  Fly   320 FDHFIQIYHQRLAECLKLLNYSKPIPTLRDL--HIMMLK-YGFWGPLTAMGVMVATLMPTDKDAN 381
            .::.|..|...|...|:.:.|...:||.|:|  .|...| |.|:...|.:.:||..     |..:
  Fly   319 GENLINEYFSVLVATLRKIGYKGDMPTQRELWEQIQNNKYYDFFLISTFLPIMVGV-----KSND 378

  Fly   382 MKMILA-QGPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLLK 423
            :||..| |..:|....|  |::.|.....| ||..::..|..|
  Fly   379 LKMHEALQDSQARLKSY--FLDDYVQDVYK-LLTKYEQLGYFK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 78/305 (26%)
APH 108..338 CDD:279908 61/247 (25%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 78/305 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459748
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.