DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and CG11889

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster


Alignment Length:428 Identity:125/428 - (29%)
Similarity:207/428 - (48%) Gaps:33/428 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PNEHLH-IPKWINEEYFQPIIEKDVENFDK--IINLVPIA---ATAPGENYTSIMIRVIVDILLK 71
            |.:..| .|.|:.|||    :||.:..:.|  .:||..:.   |||.||||.|:|.|:.|:.:.|
  Fly     2 PEKTTHNAPAWLTEEY----VEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITK 62

  Fly    72 DGSE-QRVSYILK-TMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPK--C 132
            |..: |..:::|| |..:.|..|.::...|::.:|..|||..:|:...:.|.   |:..:.|  .
  Fly    63 DSKDNQSATFLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKN---ELHDSRKLFA 124

  Fly   133 LHVDATDELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAA-SVVAKEINGPYDAMY 196
            ..|....|..:::|||||.:.:|...|:|..||.|...||.|||:.||| :.:|:...|.::..|
  Fly   125 ATVGVDRERDSIMFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNY 189

  Fly   197 NMSIYNEQSRDLFESLGKQREEQFLKAM-RNWDL-----ENAESYIARMWDPLEVFEEAVQVNQV 255
            :...:|:..|. :|.:.|    ..|||: |..||     |..::.|.|:.|  .|.:...:...|
  Fly   190 DRGFFNKHVRG-YEPIMK----NILKALSRTLDLSPDLKERYQAKIDRLID--NVMDYGERSTSV 247

  Fly   256 DEDEFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEF 320
            ...:|..|.|||.|:.|:||.|.|.|.....|.:|.|...|.|||.||.|..:||...:::::..
  Fly   248 APGDFVTLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQ 312

  Fly   321 DHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMPTDK-DANMKM 384
            ...:|.|..:|...|:.:.||..:|:|.:........||:....:: :...|::...| :.:::.
  Fly   313 TELVQFYFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASL-IFEPTMVYNGKEEPSIEQ 376

  Fly   385 ILAQGPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLL 422
            .:....:...:|...:......|.:.:.|||.|..|||
  Fly   377 FMTSDEKGVRLRDAVYQTEENLKKLHLTLPFLDQLGLL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 93/297 (31%)
APH 108..338 CDD:279908 74/238 (31%)
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 93/297 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.