DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and CG9259

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:357 Identity:89/357 - (24%)
Similarity:159/357 - (44%) Gaps:71/357 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EEYFQPIIEKDVENFD---KIIN--LVPIAATAPGENYTSIMIRVIVDILLKDGSEQR-VSYILK 83
            :.||    .:||.|.|   .|:|  |.|.:....|  |....:.:.|.:.|.:..|.| :::..|
  Fly    17 QRYF----HQDVSNSDTGFDIVNYTLKPTSDAPAG--YLGSHLYLHVTLKLHNSEEVRQLTFFSK 75

  Fly    84 TM-LEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELITMVFE 147
            :. :..:|..:.::..|:|.||..:|:..:|.   |:|...   |:||||.:.|..    .::||
  Fly    76 SAPVGNESRMEYLEDFGVFEKEIAVYQNVLPD---LHKACA---EVAPKCYYADKN----LLIFE 130

  Fly   148 DLSRQNFK---NFDRLKGFDLPHMREVLRKLAELHAASVVAKEING-------PYDAMYN----- 197
            :|:.|.::   ..|.|..::..|.  .|:.||.:||.|::.::..|       |...:.|     
  Fly   131 NLADQGYRMGAGRDGLLTYEQLHC--CLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENAYPSD 193

  Fly   198 -----MSIYNEQSRDLFESLGKQREEQFLKAMRNWD------LENAESYIARMWDPLEVFEEAVQ 251
                 |.:.|.|:..|.       .::|:|.:..:.      |||       ..:.:....|||:
  Fly   194 VSPEHMRMVNFQNACLV-------LKEFIKLIPKYQSKLDYVLEN-------FTEKMSFIFEAVK 244

  Fly   252 VNQVDEDEFNVLNHGDCWSNNIMFNYKDNGEID-RTILVDLQVGKWGSPAQDLWYLITTSASLDI 315
            .:.|.:   |.:.|||.|:|||||.|...||:. :..|||.|:.::..|..|:..::|...|.:.
  Fly   245 TSDVYQ---NTILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEF 306

  Fly   316 KIKEFDHFIQIYHQRLAECLKL--LNYSKPIP 345
            :.......:..|::.:.|.||.  |:.::.||
  Fly   307 RDAHLSELLAEYYRFMTEFLKRADLDIARFIP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 77/317 (24%)
APH 108..338 CDD:279908 64/258 (25%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 73/299 (24%)
APH <252..325 CDD:279908 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459677
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.