DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and F59B1.10

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:427 Identity:94/427 - (22%)
Similarity:163/427 - (38%) Gaps:107/427 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DVENFDKIINLVPIAATAPGENYTSIMIRVIVDI-----LLKDGSEQRVSYILKTMLEADSGADV 94
            |...|...:.|:....|.|..:....:|..||..     |:..|.:|..|.|.|.:         
 Worm    50 DGNGFSSRVLLISCNWTIPSAHLPKKLILKIVSFVHIQALIDKGKQQNASLITKEV--------- 105

  Fly    95 IDGMGLFPKERKMY--------EVHIPQFVKLYKEAG---LEIELAPKCLHVDATDELITMVFED 148
                     |.:||        ::| .|.:..|:.||   .:..|.||..       ..|.:.|.
 Worm   106 ---------EEQMYAYFESSCKKMH-NQEMNFYEVAGKFNSKTLLIPKVY-------FYTKLDEK 153

  Fly   149 LSRQNFKNFDRLKGFDLPH---------MREVLRKLAELHAASV-----VAKEI----NGP-YDA 194
            .|.:.|...:.::|..:.|         ::.:||.:|:|.|.|:     ::|::    ||. :..
 Worm   154 NSNKGFIGMEYVEGSIVRHSYDTCTIEEIQPILRAIAKLQALSLQNPAEISKDLQKIDNGAIFQE 218

  Fly   195 MYNMSIYNEQSRDLFESLGKQREEQF------LKAMRNWDLENAESYIARMWDPLEVFEEAVQVN 253
            ...|.:.....:.:||........:|      ::..||..|:               ||:|..:|
 Worm   219 TLKMMLSESGIKGIFEQCRNLERSRFGEKVDRIEEKRNEILD---------------FEKAFNLN 268

  Fly   254 QVDEDEFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDL-WYLITTSASLDIKI 317
            :|...:.|||.|||.|:.|.::. ::||....|.:||.|:...|:||:|| ..|::|....|.:.
 Worm   269 KVVGIKQNVLCHGDLWAANFLWT-ENNGVFCATRIVDYQMSHLGNPAEDLVRLLVSTITGADRQA 332

  Fly   318 KEFDHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMPTDKDANM 382
                |:.||..|..:..|..|...:...||..|   .|.:..:.|:.|:.::  .|.....||.:
 Worm   333 ----HWQQILEQFYSYFLNELGSGEAPYTLEQL---KLSFKLYFPVGALALL--PLFGPAVDAKL 388

  Fly   383 KMILAQGPEA--------------DAIRYRTFINPYY 405
            :.:.::..|.              |..:|..|...|:
 Worm   389 EGMDSEKAEKCRHVVIEKVACLLDDLEKYHKFSKRYF 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 76/328 (23%)
APH 108..338 CDD:279908 63/266 (24%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 93/422 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.