DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and E02C12.19

DIOPT Version :10

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001343835.1 Gene:E02C12.19 / 34700618 WormBaseID:WBGene00271797 Length:185 Species:Caenorhabditis elegans


Alignment Length:170 Identity:35/170 - (20%)
Similarity:52/170 - (30%) Gaps:55/170 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HIPKWINEEYFQPIIEK-----DVENFDKIINLVPIAATAPGENYTSIMIRVIVDILLKDGSEQ- 76
            |:.:...||..|.....     |.:|...|.|:         :.|..|...:.||.:.|:...| 
 Worm    14 HVTRENVEETLQKTFNTEAKFGDNKNAINISNM---------KGYMPINALIEVDWVNKEEDRQL 69

  Fly    77 ---------------RVSYILKTMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEI 126
                           .:|.|:|...|...|.|.:..:|...:|....||...:.:..|....:. 
 Worm    70 PSRFAVKISTQVPLLELSKIIKFSGENGFGEDKLKRLGKTTREFHNREVDSYKLLMRYNHPNIP- 133

  Fly   127 ELAPKCLHVDATDELITMVFEDLSRQNFKNFD---RLKGF 163
                           .|.|:      .||.||   .||||
 Worm   134 ---------------YTKVY------GFKKFDDDNDLKGF 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKL 53..340 CDD:397213 27/130 (21%)
E02C12.19NP_001343835.1 Protein Kinases, catalytic domain 3..>164 CDD:473864 35/170 (21%)

Return to query results.
Submit another query.