DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and CG31975

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:367 Identity:84/367 - (22%)
Similarity:148/367 - (40%) Gaps:64/367 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IIEKDVENFDKIINLVPIAATAPGENYTSIMIRVIVDILLKDG---SEQRVSYILKTMLEADSGA 92
            ::|..|.. .:::|....:.|.||:||.|:::.:...:...:|   .||.|:.:           
  Fly    15 VVEPHVSG-SRLLNYHTSSLTKPGDNYGSVLLAIHARLQKSNGESFEEQLVAKV----------- 67

  Fly    93 DVIDGMGLFPK-------------ERKMYEVHIPQFVKLYKEAGLEIELAPK-------C----- 132
            ..||     ||             |..:|::..|....|..|||:..|...|       |     
  Fly    68 PPID-----PKYWQFFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLE 127

  Fly   133 LHVDATDELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMYN 197
            .:....|:...:|.|:|....:.:..|||.|||.|....|:.:||.||.|:..:        :..
  Fly   128 SNSSKVDQNAVLVLENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALR--------ILR 184

  Fly   198 MSIYNEQSRDLFESLGKQRE----EQFLKAMRNWDLENAES----YIARMWDPLEVFEE--AVQV 252
            ..::.||.|..|:......|    :..:||....|:..|.:    .:|||.:..:.|.|  |...
  Fly   185 PEVFREQVRPFFKKFDWHAEAPEWKSVMKAETLEDIRRATNNDSRLVARMKELSDQFFEFLAAAP 249

  Fly   253 NQVDEDEFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKI 317
            ::.| ..|..:.|.|.|.|||||.|...|......::|.|..::.|...|:...:.:|....|..
  Fly   250 DRPD-GPFTSIIHCDFWINNIMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILE 313

  Fly   318 KEFDHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGF 359
            .||:|.::.|::....||:.:.....:.|.::..:.:.:..:
  Fly   314 VEFEHMLEAYYEAFERCLRRVGAKLEVHTFKEFRLEVKRVAY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 79/324 (24%)
APH 108..338 CDD:279908 65/251 (26%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 79/323 (24%)
APH <214..329 CDD:279908 31/115 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459607
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.