DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and CG33301

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:433 Identity:129/433 - (29%)
Similarity:200/433 - (46%) Gaps:57/433 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IPKWINEEYFQPIIEKDVENFDK--IINLVPIAATAPGENYTSIMIRVIVDILLKDGSEQRVSYI 81
            :|.|:...|.||.:....:: |:  ::.:....||..|||:..:|.|:.||..|.|||....:||
  Fly     2 LPTWLTAAYLQPRLRAYCQD-DRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYI 65

  Fly    82 LKTMLEAD-SGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELITMV 145
            :|..|.|: ..|:|.....|:.:|..|||..:|:..:|.:||||:.:|....:.||.  |..||:
  Fly    66 VKQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDR--EYNTMI 128

  Fly   146 FEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMYNMSIYNE-QSRD-- 207
            .|||:...|.|.||:|..|:.|....|..||:.||||:|.:|   .:..:.....|.. .|||  
  Fly   129 LEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQE---RHPNLLTKCFYTHFFSRDKK 190

  Fly   208 ----LFESLGK----------QREEQF---LKAMRNWDLENAESYIARMWDPLEVFEEAVQVNQV 255
                :|..|.|          ..:|.:   |..:|...:|    |.||.:|             |
  Fly   191 AYSVVFAGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIME----YGARAYD-------------V 238

  Fly   256 DEDEFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEF 320
            .|.:...|||||||:.||||.|.|.||....:.:|.|.....||..||.|..|||...::..|| 
  Fly   239 GESDLKTLNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKE- 302

  Fly   321 DHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMPTDKDANMKMI 385
            ...::.:::.|...|:..:|...:|||::..:...:..|...|..|.........:::.::...:
  Fly   303 SELVEHHYKALKANLEKFSYKGSLPTLQEYRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFSSL 367

  Fly   386 LAQGPEADAIRYRTFINPYYA-----KAMKVLLPFFDNKGLLK 423
            .|:.||  .:||:..:   ||     ::...||...|.||||:
  Fly   368 YAESPE--GLRYQKSV---YASEAVIRSATKLLAILDAKGLLE 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 100/307 (33%)
APH 108..338 CDD:279908 79/249 (32%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 100/307 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459378
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.