DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and T16G1.3

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:410 Identity:86/410 - (20%)
Similarity:156/410 - (38%) Gaps:118/410 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DVENFDKIINLVPIAATAPGEN--------YTSIM--IRVIVDILLKDGSEQRVSYILKTMLEAD 89
            |...|...:.||....|..||:        .||.|  :.|:..:.|:|.||..:..|.:      
 Worm    18 DGNGFMSRVILVEPDWTVHGEHLPNRFVLKITSCMHVLNVLDQMNLQDKSESALWSIFE------ 76

  Fly    90 SGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCL------HVDATDELITMVFED 148
                 .:..||..:|..:||:       :.|....::.::||..      ..:.|.....|.:.|
 Worm    77 -----YEAQGLHNREVNLYEI-------IGKWNMDDVLMSPKVFFSKKFDSENLTKGFFAMEYVD 129

  Fly   149 --LSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMYNMSIYNEQSRDLFES 211
              ::|..:.|   ||.::|   ..:|:.||...|                             ||
 Worm   130 NAITRHLYIN---LKSYEL---HSILKSLAVFQA-----------------------------ES 159

  Fly   212 LGKQREEQFLKAMRNWDLENAESYIARMWDP---LEVFEEAVQVNQVDEDEF------------- 260
            |...:.||  :::..:||   |..:.:|:..   ..:||:..|:|:.:..|.             
 Worm   160 LKLNKREQ--ESVTGYDL---EKIVGKMFSQNGLNSIFEQVRQINKEELSEAADKIAVFGVELVN 219

  Fly   261 ---------------NVLNHGDCWSNNIMF-NYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITT 309
                           |||.|||.||.|||: ..||...:|:  ::|.|....|:||:||..|..:
 Worm   220 FDLVKNLNNYLGIKKNVLVHGDLWSANIMWKENKDEFRVDK--IIDYQSIHLGNPAEDLVRLFIS 282

  Fly   310 SASLDIKIKEFDHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIM------MLKYGFWGPLTAMGV 368
            :.|...:.|.::..::.:::...|.|:..|....:..|::.:.:      :|....:||:..  |
 Worm   283 TLSGSERQKYWEKLLEQFYEYFIEALEDKNVPYTLEQLKESYRLYFVTGSLLMLPMFGPIAE--V 345

  Fly   369 MVATLMPTDKDANMKMILAQ 388
            .:|.:...|:....:.||.:
 Worm   346 KLAEMSDPDEVKKYREILTE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 71/336 (21%)
APH 108..338 CDD:279908 57/269 (21%)
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 86/410 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.