DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and F56A4.5

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_503669.1 Gene:F56A4.5 / 186348 WormBaseID:WBGene00018913 Length:418 Species:Caenorhabditis elegans


Alignment Length:334 Identity:59/334 - (17%)
Similarity:113/334 - (33%) Gaps:95/334 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PQFVKLYKEAGLEIELAPKCLHVDATDELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAE 177
            |.:|...|...|     |....|..:.:|...||..:::     ||...||....::.:.:.:.|
 Worm    58 PDWVGAEKNQNL-----PSKFAVKISTQLAFAVFSKITK-----FDGGNGFGEEKLKFLGKFIRE 112

  Fly   178 LHAASVVA----KEINGPYDAMYNMSIYNEQSRDLFESLG------------------------- 213
            .|...|.|    :::|.| |..:..:.|.:..:|.|:..|                         
 Worm   113 GHNREVEAYKLLEKLNHP-DIPHTKAYYLKPFKDKFDLKGFMILDFVPNVHPMPMYESIPADDLI 176

  Fly   214 ----------------KQREEQFLKAMRNWDLENAESY----IARMWDPLE---------VFEEA 249
                            ...:..|.:....::|...|.|    :.|:...::         |.||.
 Worm   177 SLVRGVATFAGHGESLTAEQRSFARGSDIFELMFEEMYPDEQLERVCGVIQATFGAKNPAVVEEC 241

  Fly   250 VQVNQVDEDEFN-------------VLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQ 301
            :::..:.::...             ||||||.|.:|::....::|.:....::|.|......|..
 Worm   242 IKLFWIYKNSIKSYSKVSELLGFKLVLNHGDLWQSNMLHCLDEHGNLVLKAIIDWQGVSMLPPGL 306

  Fly   302 DLWYLITTSASLDIKIKEFDHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAM 366
            ||..|:....:...:.:.....:.:|||.....:....:|  :..|:|      .|..:.|    
 Worm   307 DLARLLMGCLTAYERRERGAELLMLYHQTFTGIVGEELFS--LEELQD------SYNLYYP---- 359

  Fly   367 GVMVATLMP 375
             :|..||:|
 Worm   360 -IMTLTLVP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 50/297 (17%)
APH 108..338 CDD:279908 50/295 (17%)
F56A4.5NP_503669.1 DUF1679 3..409 CDD:369592 59/334 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.