DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and E02C12.12

DIOPT Version :10

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_505432.2 Gene:E02C12.12 / 183991 WormBaseID:WBGene00017097 Length:200 Species:Caenorhabditis elegans


Alignment Length:103 Identity:20/103 - (19%)
Similarity:41/103 - (39%) Gaps:18/103 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PQFVKLYKEAGLEIELAPKCLHVDATDELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAE 177
            |.::.:.|...|     ||...|..:.:|...|...:.:...:|     ||....:.|:.:.:.:
 Worm    35 PDWIDVEKGKDL-----PKKFAVKISTQLALAVLSKIMKLGGEN-----GFSEEKLNELGKLIRD 89

  Fly   178 LHAASVVAKEI-------NGPYDAMYNMSIYNEQSRDL 208
            .|...|...::       :.||..:|.:..|:: :.||
 Worm    90 GHNREVATYKLLEKMNHPDIPYTKVYGLKGYSD-ANDL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKL 53..340 CDD:397213 20/103 (19%)
E02C12.12NP_505432.2 Protein Kinases, catalytic domain 1..>200 CDD:473864 20/103 (19%)

Return to query results.
Submit another query.