DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and C29F7.1

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:256 Identity:66/256 - (25%)
Similarity:113/256 - (44%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GADVIDGMGLFPKERKMY--EVHIPQFVKLYKEAGLEIEL---APKCLHVDATDELITM-VFEDL 149
            |.||..|......|..|:  |.:.....:.|.:..:::.:   |.|....:|...:|.| :|||.
 Worm    87 GVDVNKGNAAAIMELFMHNTECNYYNVFRKYTDLPMKVPVIYCAAKAGDAEAPVPVIVMEMFEDC 151

  Fly   150 SRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEING--PYDAMYNMSIYNEQSRDLFESL 212
            :..     |.:.|||...:.:::.::..||..|:..:|...  |..||       ..:.||||::
 Worm   152 TVH-----DLIDGFDKDQLFKIVDEIVNLHIFSLTTEEWRSVLPDSAM-------RDTVDLFEAM 204

  Fly   213 GKQREEQFLKAMRNWDLENAESYIARMWDPLEVFEEAVQVNQVDEDEFNVLNHGDCWSNNIMFNY 277
            .|...|...|:.   .||....||.:.:|....|........::....:||.|||.||..|:::.
 Worm   205 VKTIAENMAKSP---GLEIISKYIEKTFDKDPSFMTKFSDEYLEGKRKSVLTHGDLWSPQILWDK 266

  Fly   278 KDN--GEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHFIQIYHQRLAECLK 336
            .||  |      ::|.|||..|||.:||..:::|..|::.:.|.....:..|.::|:..|:
 Worm   267 DDNIAG------IIDWQVGHQGSPMEDLHRILSTGTSVENRNKLTKPLLDHYFEKLSAGLE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 66/256 (26%)
APH 108..338 CDD:279908 60/239 (25%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 55/201 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto19598
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17008
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.