DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and T16G1.7

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_506233.1 Gene:T16G1.7 / 179774 WormBaseID:WBGene00011801 Length:436 Species:Caenorhabditis elegans


Alignment Length:365 Identity:88/365 - (24%)
Similarity:145/365 - (39%) Gaps:76/365 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DVENFDKIINLVPIAATAPGENYTSIMIRVIVDILLKDGSEQRVSYILKTMLEADSGADVIDGMG 99
            |...|...:.||....|.|.|:.....|..|...|...|           ::|...|    ...|
 Worm    52 DGNGFMSRVILVEPEWTVPDEHLPEKFILKITSCLHVHG-----------LVEKMKG----KSPG 101

  Fly   100 LFPKERK-----MYEVHIPQF----VKLYKEAGL----EIELAPKCL---HVDA---TDELITMV 145
            .||.|::     ::|....|.    |.|||....    |..|:||..   ..||   |..::.|.
 Worm   102 AFPAEQEAALWAIFENEAQQLHNREVNLYKITEKWNKNETMLSPKIYFYKKFDAENKTKGILGME 166

  Fly   146 F-EDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAAS--VVAKEING----PYDAMYNMSIYNE 203
            | .|::.::.  :...|.::|   ..|||.||.|.|.|  :...|||.    .:..|....:..|
 Worm   167 FVSDVTIRHL--YCNAKPYEL---HPVLRSLATLQAGSLHLTEDEINSISGFDFKQMMGAMMNEE 226

  Fly   204 QSRDLFESLGKQREEQFLKAMRNWDLENAESYIARMWDPLEV--FEEAVQVNQVDEDEFNVLNHG 266
            ..::::|...:...|:..:     .....|::      .|||  ||.:..:|:....|.:||.||
 Worm   227 GMKNIYEQTREINPERLTE-----KTNTVEAF------GLEVVNFELSCNLNKYVGIERDVLVHG 280

  Fly   267 DCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDL-WYLITTSASLDIKIKEFDHFIQIYHQR 330
            |.|:.||::..:::|:...:.::|.|:...|:||:|| ...::|.:..|.:.    |:.::..|.
 Worm   281 DLWAANILWKEENDGKFSVSKVIDYQLIHMGNPAEDLVRVFLSTLSGADRQA----HWERLLEQF 341

  Fly   331 LAECLKLLNYSKPIPTLRDLH------------IMMLKYG 358
            ....|:.|...||..:|..|.            :||..||
 Worm   342 YEYFLEALGDDKPPYSLEQLKESYRCYFVSGGLVMMPMYG 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 75/315 (24%)
APH 108..338 CDD:279908 62/253 (25%)
T16G1.7NP_506233.1 DUF1679 10..423 CDD:369592 88/365 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.