DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10550 and F59B1.8

DIOPT Version :9

Sequence 1:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:412 Identity:87/412 - (21%)
Similarity:155/412 - (37%) Gaps:89/412 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FDKIINLVPIAATAPGENYTSIMIRVIVDI-----LLKDGSEQRVSYILKTMLEADSGADVIDGM 98
            |...:.|:....|.|..:....:|..||..     ||...:|:              |..|:.  
 Worm    54 FSSCVILITCHWTIPSSHLPKKLILKIVSFVHVQGLLNKSNEE--------------GNSVMS-- 102

  Fly    99 GLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELITMVF------EDLSRQNFKNF 157
               |:|......|..:  ...|...||:|......|::..  |:..||      ||...:.|...
 Worm   103 ---PEEEAHVHAHFEK--SCQKGHNLEVEFCEAFGHLEGL--LLPKVFFSQKFEEDNPNKGFVGM 160

  Fly   158 DRLKGFDLPH---------MREVLRKLAELHAASVVAKEI----NGPYDAMYNMSIYNE------ 203
            :.::|..:.|         ::.:|:.||.|.|.|:..:..    ||.......|.:.:|      
 Worm   161 EFVEGSVVRHCYENVTVDELQPILKALARLQALSLSTESCRNLDNGEAFEESLMDMLSEDGLKGI 225

  Fly   204 --QSRDLFESLGK--QREEQFLKAMRNWDLENAESYIARMWDPLEVFEEAVQVNQVDEDEFNVLN 264
              |||::.:.|.:  :|.||..|.:.|                   .|..:.:|:|...:..|:.
 Worm   226 FDQSRNIDQKLSEKVERIEQNHKEILN-------------------LETVLNLNKVVGIDQKVIC 271

  Fly   265 HGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHFIQIYHQ 329
            |||.|:.||::...|.|.|...:| |.|....|:||:||..|:.::.|...:...::|.::.::.
 Worm   272 HGDLWAANILWTQTDGGFIADKVL-DYQESHMGNPAEDLVRLLVSTISGADRQSHWEHILEQFYT 335

  Fly   330 RLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGV------MVATLMPTDKDANMKMILAQ 388
            ...:  ::.:.:.|. ||..|......|...|.||.:.:      |....|.:.|..|.:.|:.:
 Worm   336 YFTD--EIGSNNAPY-TLEQLKTSFKLYFPVGALTLISLFGPAVDMKLQGMESGKAENYRRIVIE 397

  Fly   389 GPEA---DAIRYRTFINPYYAK 407
            ..:.   |.:.:..|...:..|
 Worm   398 KVDCLLDDVLNFHDFNKKFTGK 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 68/320 (21%)
APH 108..338 CDD:279908 57/258 (22%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 86/405 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.