DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and pkdc

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:332 Identity:71/332 - (21%)
Similarity:114/332 - (34%) Gaps:99/332 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IIRARVEYITQKGFFSKSLIIKTVL----EMFAGSALFKTEIGMYRKVLP-EFARILREN---ND 111
            |||..:|     |....|:::|.|:    :...|.  :.|:|...|||.. :......:|   |:
Zfish    34 IIRVHLE-----GCDRPSVVVKHVMFPQNQKHPGG--WNTDISHQRKVRSYQVETYWYQNYTTNE 91

  Fly   112 TSRLYAECIYYSLEPSQVMIFEDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKIINE--- 173
            ..|:.......|....|:::.|||....:. ||...:...||....|.:|.||||.:.:..|   
Zfish    92 NCRVPLCLAAKSFGEEQLIVLEDLDVAGFP-VRKTYVNDAEIKACLSWIANFHALFLDVTPEGLW 155

  Fly   174 ----------RPEFVKEFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRL 228
                      |||.::...|       ..:.:..|.....|...    |:||             
Zfish   156 PIGTYWHLETRPEELEAMSD-------QKLKAAAGEIDSILNNC----RFKT------------- 196

  Fly   229 RDIMKEYQTNPQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAF-------- 285
                             :.|||....|.             |...|  |..||.:.|        
Zfish   197 -----------------IVHGDAKLANF-------------CFSKD--GLQVASVDFQYVGGGCG 229

  Fly   286 --DLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEF-L 347
              |::|.:...|:..:...:...||:||||.||::|.|   :....:....|:.|:.....:| .
Zfish   230 MKDVIYFLGSCMDERECEKKAPGLLDYYFSELRKSLEK---KVDFAELEKEWRNMFAFAWTDFHR 291

  Fly   348 FLSTYLP 354
            ||..::|
Zfish   292 FLLGWMP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 65/299 (22%)
APH <202..320 CDD:279908 25/127 (20%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 47/227 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.