DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP007947

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_001237942.2 Gene:AgaP_AGAP007947 / 4578412 VectorBaseID:AGAP007947 Length:284 Species:Anopheles gambiae


Alignment Length:48 Identity:13/48 - (27%)
Similarity:24/48 - (50%) Gaps:3/48 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VMIFEDLGEMDYAMV-RDRVLTHGE--ICGAYSKLAKFHALSMKIINE 173
            |::.|:|....:..: .|...|..|  |..|.:.||:||:.::.:..|
Mosquito     4 VLVLENLKTQGFETIPSDATRTFDEEHIKCALAALARFHSATILLEKE 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 13/48 (27%)
APH <202..320 CDD:279908
AgaP_AGAP007947XP_001237942.2 PKc_like <3..>67 CDD:304357 13/48 (27%)
COG5048 <96..267 CDD:227381
C2H2 Zn finger 143..164 CDD:275368
zf-C2H2_6 170..192 CDD:290623
C2H2 Zn finger 172..192 CDD:275368
C2H2 Zn finger 199..219 CDD:275368
C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 258..278 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.