DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP010765

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_001231175.1 Gene:AgaP_AGAP010765 / 4577909 VectorBaseID:AGAP010765 Length:191 Species:Anopheles gambiae


Alignment Length:163 Identity:42/163 - (25%)
Similarity:75/163 - (46%) Gaps:18/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DSLA--DQLNVPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQK 66
            |::|  |.:.|||:::|:.....|........:|:.:...|..:|.||||.|.:.|..|.|:.::
Mosquito     6 DTIAGLDDIAVPEYIDERLAAKALVDGLGLQSVRIVECKITRATANGDNYMSDVFRLAVRYVAEQ 70

  Fly    67 GFFSK--SLIIKTVL------EMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLY--AECIY 121
            ....:  ||::|::.      .|......:..|..|:|.|:|..:.:      |..::  |.|.|
Mosquito    71 SGDERTISLVVKSLPATGQRGPMIEEVQAYTKEATMFRDVVPALSEL------TGGMFFAARCFY 129

  Fly   122 YSLEPSQVMIFEDLGEMDYAMVRDRVLTHGEIC 154
            .|..|.::::||||..:.|..|..:.....|.|
Mosquito   130 ASDLPERLLVFEDLKALGYVTVNRQAGLDFEHC 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 31/118 (26%)
APH <202..320 CDD:279908
AgaP_AGAP010765XP_001231175.1 PKc_like 51..>183 CDD:304357 31/118 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.