DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP003766

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_310299.2 Gene:AgaP_AGAP003766 / 4577158 VectorBaseID:AGAP003766 Length:412 Species:Anopheles gambiae


Alignment Length:429 Identity:101/429 - (23%)
Similarity:184/429 - (42%) Gaps:60/429 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DQLNVPE---WLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYIT-QKGF 68
            ||..:.|   ::...::..:||..:.|..::|.........|||:||:|.|:|..|.|.| ....
Mosquito     2 DQATIEEKYPFITRDYLQGILRREQCESAIKVESFKVVAPLAKGENYSSDILRVTVNYTTGSHNH 66

  Fly    69 FSKSLIIKTVL------EMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPS 127
            .:::.|||...      ::.....:||.||.:|..|:|:..::|.....:.||..  :.:::..:
Mosquito    67 RTQTYIIKVSFARDEDADLLDAYDVFKREIAVYDVVMPKVEQLLSSIGYSKRLAP--VAHAIHAT 129

  Fly   128 QV--MIFEDLGEMDYAMV-RDRVLTHGEICGAYSKLAKFHALSMKI--INERPEFVKEFKDGICL 187
            .:  .:||||....|..| |...|..|::.....|:|||||.:..:  |.|.......:::  ..
Mosquito   130 TIKHFVFEDLSLQGYKPVGRAAGLNFGQLQLVLEKIAKFHAATAVLYSIEEDAMAAHHYRN--IS 192

  Fly   188 VDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMK-------EYQTNPQPGYYV 245
            .|:|:.      :..|...:.......:::...:....::|..:.|       ...|..:..:.|
Mosquito   193 EDVPHF------YPLFQNSVVACGEQASNWPTTKGKIAEKLCALEKTIIAKGCRVYTRTETDFNV 251

  Fly   246 LCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNY 310
            |.|||....|:|:| .:.||...|.:|:||...:....|.||.|.::...:.:..:.:.:.||.:
Mosquito   252 LNHGDLWVNNVMLK-TEPSGKPTDAILVDYATGFFGSPAIDLSYLLFTSASNDVTVEDFDLLLQH 315

  Fly   311 YFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYL-PMSVGLSLETATNEE------ 368
            |...|.:||.|:.|..::|.......||.| |.:..:..||:| |:.:   ||...|.:      
Mosquito   316 YHGELVDTLTKLKYAKRVPTLLDIQVEMLR-KGHNGVMFSTFLIPLRL---LEDTANADLGGLLG 376

  Fly   369 -TDD------------KLQDFIEECKSILARFERSGYFE 394
             |::            |.||.:|   .:|..::|.||.:
Mosquito   377 RTEEAIAFRKRLFSHPKYQDRME---YLLNFYDRKGYLD 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 71/295 (24%)
APH <202..320 CDD:279908 27/124 (22%)
AgaP_AGAP003766XP_310299.2 EcKinase 44..329 CDD:281023 71/295 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.